KEGG   Danio rerio (zebrafish): 437020
Entry
437020            CDS       T01004                                 

Gene name
ube2b
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 B
  KO
K10574  ubiquitin-conjugating enzyme E2 B [EC:2.3.2.23]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    437020 (ube2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    437020 (ube2b)
   03400 DNA repair and recombination proteins [BR:dre03400]
    437020 (ube2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     437020 (ube2b)
Ubiquitin system [BR:dre04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   437020 (ube2b)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    437020 (ube2b)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 437020
NCBI-ProteinID: NP_001002747
ZFIN: ZDB-GENE-040718-247
Ensembl: ENSDARG00000026035
Vega: OTTDARG00000037383
UniProt: Q6DGE1
Position
21
AA seq 152 aa
MSTQARRRLMRDFKRLQEDPPTGVSGAPSENNIMLWNAVIFGPVGTPFEDGTFKLVIEFS
EEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAVVEQSWVDS
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtccacacaggccagacgaagactcatgagggacttcaagagacttcaagaagaccct
ccgaccggcgtgagcggcgctccttcagaaaacaacatcatgctgtggaacgctgtcatt
tttgggcctgtaggaactccctttgaggacggaacatttaagctggttattgagttctca
gaagagtatcccaacaagccgccgacggttcgcttcgtctccaaaatgtttcaccccaac
gtgtatgcggatggcagtatatgtttagacattcttcagaaccgatggagtcccacatat
gacgtctcctccatcctcacatccatccagtctctgctggacgagccaaacccgaacagc
ccagcgaacagtcaggcggctcaactgtaccaggagaataagcgtgaatatgagaagaga
gtttctgccgtggtggagcagagctgggtggactcataa

DBGET integrated database retrieval system