KEGG   Danio rerio (zebrafish): 445105
Entry
445105            CDS       T01004                                 
Symbol
lipia
Name
(RefSeq) lipase member H precursor
  KO
K19404  phosphatidic acid-selective phospholipase A1 [EC:3.1.1.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    445105 (lipia)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     445105 (lipia)
SSDB
Motif
Pfam: Lipase Abhydrolase_2
Other DBs
NCBI-GeneID: 445105
NCBI-ProteinID: NP_001003499
ZFIN: ZDB-GENE-040801-242
Ensembl: ENSDARG00000007108
UniProt: Q6DBU8
Position
21:complement(34945033..34981102)
AA seq 454 aa
MIYRKIIWGILYVTLMLFDTHRAQECEEMTDLNFKDSLAGTSLKVRLLLYTRADPSCGQL
LSHQEPFSNSQFNVSSVTTFLIHGYRPTGSPPVWMKQFVEFLLNRRDMNVIVVDWNRGAT
NMNYWQVVKNTRKVANNLTDLIQKMKDNGANLSSIHMIGVSLGAHISGFTGANFNGEIGR
ITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDMDALGYRNLLGHIDYYANGGADQPGC
PKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCESYTDFQDGTCMDCGKFKSAGCP
IFGYDSVRWRDTLVQLEQTRTYFQTNKASPFCKVGYKVDIVSWNQKTHWGYLTIKLSNGT
EETQVELNHKSLKFERFQETSVLAQFERDIQPVKKITLKFCPRKGLRPRKKLRLLHIRLT
PLQNHLRPLCRYDLLLEESKDVTFKPIPCEDSNF
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgatctacaggaaaataatttgggggatcttatatgtcacactgatgttgtttgacaca
cacagagctcaggaatgtgaagagatgacagaccttaactttaaagactccctcgctggt
acatctttgaaagttagactgctgctttacacacgagctgatccgtcctgcggtcagctg
ctttctcaccaggagcccttcagtaattcccaattcaacgtcagctctgttaccaccttc
ctcatccatgggtaccggcccaccggctcaccccctgtttggatgaaacaatttgtggag
ttccttctgaaccgccgcgatatgaatgttatcgtggtggattggaatcgtggagcaacc
aacatgaactactggcaagttgtgaaaaatacacgcaaggtggctaataatcttacggac
ctcatccaaaaaatgaaggacaatggggccaatctcagctctatacacatgataggtgtc
agtctgggagcccacatttcaggtttcactggggccaactttaatggtgaaattggtaga
ataacagcactggatccagcagggccagagttcaacggtcggccccctgaggaccgttta
gacccttctgatgccctgtttgtggaagccctacacacagacatggatgcattaggctat
cgaaatcttctgggtcacatcgactactacgccaatggaggggcagatcagccaggatgt
cctaaaaccatcctatcaggatccgagtattttaagtgtgaccaccagaggtcagtgttt
ctctatatgagttccgtgaacggctcctgtcccattattgcctacccctgtgaatcctac
actgacttccaagacgggacgtgcatggattgtgggaaatttaagtcagccggatgccct
atttttggttatgattctgtacgctggagggacaccctggtgcagcttgaacaaacaagg
acatattttcaaacgaataaagcttctccgttctgcaaggttggctacaaggttgatatc
gtatcgtggaaccagaaaacccactggggatatttgacaattaaattatccaatggaact
gaagagacacaagtagaactcaatcataaatccttaaagttcgagaggtttcaggagacc
tctgtcctggctcagtttgagagagacattcagcctgttaaaaagatcacactgaagttc
tgccccagaaaaggactgcggccacgcaagaaactgcggcttctgcatatacgcctcact
cctctacagaaccacctcaggcctctgtgtcgctacgatcttctgctggaggaaagtaaa
gatgtgaccttcaaacctattccatgtgaagactccaacttttga

DBGET integrated database retrieval system