KEGG   Danio rerio (zebrafish): 445391
Entry
445391            CDS       T01004                                 

Gene name
nop10
Definition
(RefSeq) H/ACA ribonucleoprotein complex subunit 3
  KO
K11130  H/ACA ribonucleoprotein complex subunit 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    445391 (nop10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dre03009]
    445391 (nop10)
   03032 DNA replication proteins [BR:dre03032]
    445391 (nop10)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic type
  Sno RNPs
   Box H/ACA snoRNPs
    445391 (nop10)
 Prokaryotic type
    445391 (nop10)
DNA replication proteins [BR:dre03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     445391 (nop10)
SSDB
Motif
Pfam: Nop10p
Other DBs
NCBI-GeneID: 445391
NCBI-ProteinID: NP_001003868
ZFIN: ZDB-GENE-041007-4
Ensembl: ENSDARG00000104227
Vega: OTTDARG00000043390
UniProt: Q6DRH5
Position
7
AA seq 64 aa
MFLQFYLNENGERVYTLKKVDPSGQPTSSAHPARFSPDDKFSRHRVTIKKRFGLLLTQQP
RPVL
NT seq 195 nt   +upstreamnt  +downstreamnt
atgttcctgcagttttacctcaatgagaatggcgagagggtttacactctgaagaaagtg
gaccccagtggtcagcccaccagctcggctcatccggcccgattctcacccgacgacaag
ttctccaggcaccgagtgaccatcaagaagagattcggactcctgctgacgcaacagccc
cggcctgtgctctaa

DBGET integrated database retrieval system