KEGG   Danio rerio (zebrafish): 445392Help
Entry
445392            CDS       T01004                                 

Gene name
fbxo5
Definition
(RefSeq) F-box only protein 5
  KO
K10292  F-box protein 5
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    445392 (fbxo5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    445392 (fbxo5)
   03036 Chromosome and associated proteins [BR:dre03036]
    445392 (fbxo5)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     445392 (fbxo5)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    445392 (fbxo5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBR F-box-like F-box
Motif
Other DBs
NCBI-GeneID: 445392
NCBI-ProteinID: NP_001003869
ZFIN: ZDB-GENE-030131-4027
Ensembl: ENSDARG00000039020
Vega: OTTDARG00000042841
UniProt: Q0V967
Position
13
AA seq 384 aa AA seqDB search
MKCPNYTEDSTVLCHMEKTETDLGEVKGHKVSPRKTGALPLRSPAATNVSTPLESRSKGP
HNKENYQNKRHSLDMASDDEVIFSGSGLTEDSGYLSLHNSQVDVDGLDSLERSEENCVSS
QSLDVECHSGPCLPVLNFQEEACRELQRSYKKNRSYDWTVVDKVAENFGLHNVIGGKMGR
QFVDILCKLMRKDMRHILARILGLLADCDLISCTKVSRTWRKIICQDQLALQRWKKAEKT
RRDSGRSMGSLSRDFTLDRVVFSCMQTVSSPPAHKAVKKPPCHMGGAQNATKSSRFQQYV
EAAQSLKQHESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSNPCRNTI
RSFSSTQKTLVAGSARSKRSIRRL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtccaaactacactgaggattccacggttttatgccacatggagaagactgaa
acagacctgggtgaggtgaagggccataaggtttcgccacgaaaaacaggagccctcccc
ctgcgctcccccgcagccaccaatgtctccacacctctggagagccgaagcaaaggcccc
cataataaagaaaactaccagaacaagagacattcactggatatggcatcagatgatgag
gtgatcttcagtggcagcggcctgaccgaagacagcggttacctttccctccataacagc
caggtggacgtggacggactggactcattagagaggagtgaagagaattgtgtgtcctct
caatccttggacgttgagtgtcattctggaccctgtttacctgtgctgaacttccaggag
gaggcctgccgagagctgcagaggagctacaagaagaaccgaagctacgattggaccgtc
gtcgataaagtggcggagaattttgggttgcataatgtgattggtggaaaaatgggacgg
cagttcgtggatatcctctgcaagctgatgaggaaggacatgaggcacattcttgccagg
attttgggcctgctggcagattgtgacttgataagctgtacgaaagtaagccggacgtgg
aggaaaataatttgtcaggatcagttggctcttcagcgctggaaaaaagcagaaaaaaca
cgcagggactcgggccggtctatgggatctttatctcgagacttcaccttggacagggtg
gtgttctcctgcatgcagaccgtttcctctccacccgctcacaaggctgttaagaagccg
ccatgccatatgggtggagcgcaaaatgcgactaaatcaagccggtttcaacagtatgta
gaggcagcacagtctctgaaacagcatgaatccctgcggcgctgctcccgctgcagttct
ccggcacgctttgatgcagtaatgcagagggccgtttgcacacgcatcagctgcgccttt
gagttttgcacattgtgtcaatctgctttccatgactccaatccgtgccgaaacaccatc
cggagtttttcctccacacaaaaaacactggttgccggctccgctcgaagcaagaggagc
atccgtcgcctctga

DBGET integrated database retrieval system