KEGG   Danio rerio (zebrafish): 445413
Entry
445413            CDS       T01004                                 

Gene name
psmb1
Definition
(RefSeq) proteasome subunit beta type-1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    445413 (psmb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    445413 (psmb1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dre03051]
    445413 (psmb1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     445413 (psmb1)
Peptidases and inhibitors [BR:dre01002]
 Threonine peptidases
  Family T1: proteasome family
   445413 (psmb1)
Proteasome [BR:dre03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    445413 (psmb1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1
Other DBs
NCBI-GeneID: 445413
NCBI-ProteinID: NP_001003889
ZFIN: ZDB-GENE-040618-2
Ensembl: ENSDARG00000009640
Vega: OTTDARG00000020627
UniProt: Q6DRF3
Position
13
AA seq 237 aa
MISAQAYGENGKMKEYHYTGPVEHKFSPYAFNGGTVLAVAGEDFAIVASDTRLSEGYSIH
SRDSPKCYKLTDTTVLGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAMLSTIL
YGRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFK
NMENVEHVPLTQEKAVQLVKDVFISAAERDVYTGDALKVCIVSKEGIKEEIVPLRKD
NT seq 714 nt   +upstreamnt  +downstreamnt
atgatttctgcccaggcttatggagaaaacggcaaaatgaaagaatatcactatacagga
ccagtggagcacaaattctccccttatgccttcaacggagggacagtgctggcggtggct
ggtgaagattttgctatcgtggcctcagacacacgtttaagtgaaggttacagcatccac
agcagagactcgcccaaatgctacaagctgacagacactacagttctgggctgcagtggt
tttcatggagactgcctgacgctcaccaaaatcattgaggcccgactgaagatgtacaag
cactcgaataacaagagcatgacgagtggagccatcgcagccatgctgtccaccattctg
tacggcaggcgcttcttcccttactacgtctacaacatcatcggcggtctggatgaggag
ggtcgaggtgctgtttatagttttgatccagttggttcctaccagagggacacgtataaa
gcaggtggatcagcgagcgcaatgctgcagccgctcctcgacaaccagatcggcttcaag
aacatggagaacgtggagcatgttcctctgacccaggagaaggcagtgcagctggtgaag
gacgtgtttatttctgctgccgagagagacgtgtacaccggagacgccctcaaagtctgc
atcgtctccaaagagggcattaaagaagagatcgtgccgctcaggaaagactga

DBGET integrated database retrieval system