KEGG   Danio rerio (zebrafish): 445819
Entry
445819            CDS       T01004                                 

Gene name
wdr18
Definition
(RefSeq) WD repeat-containing protein 18
  KO
K14829  pre-rRNA-processing protein IPI3
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dre03009]
    445819 (wdr18)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic type
  Pre-60S particles
   5-FMC complex
    445819 (wdr18)
SSDB
Motif
Pfam: WD40_alt WD40 ANAPC4_WD40 Nup160 Ge1_WD40
Other DBs
NCBI-GeneID: 445819
NCBI-ProteinID: NP_001005206
ZFIN: ZDB-GENE-040905-4
Ensembl: ENSDARG00000041113
Vega: OTTDARG00000020469
UniProt: Q68EI0 B2GT94
Position
11
AA seq 431 aa
MSAPVEVVLSADSAGQLFNCAVYDPHTGSEFLSYRGGNTSSRSLTILNGEYILGAQLGKN
YINVWEIQRKDQLQQKIVCPGIVTCLCASPDGLYVLAGIAEAIYLWEVSTGNLLAILSRH
FQDLSCIKFTDDSSHFVSGGKDNLAFIWNLSSVVQLDSSRTPEPRHILSRHSLPITDIHC
GLMGPQARVATASLDQTVKVWEISSGEMLLSVLFDVGIMSVTFDPCEYFLFCGGSDGNIF
QVSLCSTSLSRDKTFQSDSEGNQVFKGHRNLVTCLSVSMDGTVLLSGSNDETVRMWDVQS
KQCIWTINHRGPVTNAAIIPAPANMFLSDSHPAVPLPRFSRHLNPSEQGDGTGTGGMSLR
LGANTQEPEGTYLEKAEELYSLMCAVTDKSVFGDGENTKVRVSELEEEVRTLKKINKDLY
EFSTQLLTKPN
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgtcggcgcccgtggaagtagttctgtctgcagattcagcgggtcagctgtttaactgt
gcggtttatgacccacataccgggtcagaattcttatcctatcgcggaggaaacacctct
tccaggtctttaacgattctaaatggagaatatatattaggagctcaactcggcaagaac
tacataaacgtgtgggagatccaaaggaaggaccagctacagcagaagattgtgtgtcct
gggatcgttacatgtctttgcgcgtctcctgatggtctttatgtgctagcaggcattgct
gaagctatatacctgtgggaggtgtcaacaggaaatttgttggccattttgagccgccac
tttcaggacctgagttgcatcaagttcactgatgacagcagtcactttgtgtctggaggg
aaagacaatctggctttcatatggaatctctccagtgttgttcagctggattcatcccgt
acaccagaaccccgacacattctgtcccgacactctctcccaatcactgacatccactgt
ggcctgatgggaccacaagctcgtgttgccactgcttccctggaccaaaccgttaaggtt
tgggaaatatcctctggggagatgctgctgtctgtcctcttcgatgttggcatcatgtca
gtgacttttgacccctgcgagtattttctgttctgtggaggcagcgatggcaacattttt
caagtctctctctgcagcacgagtttaagccgagataaaaccttccagtcggacagtgaa
ggcaatcaggtgttcaaaggacacagaaatctggtaacatgtctgtctgtgtccatggac
ggcaccgtccttctttccggctccaatgatgagaccgtccgcatgtgggatgttcagagc
aagcagtgcatatggaccatcaaccacagaggtcctgtgaccaatgctgccatcatacca
gcacctgccaacatgtttctttctgacagtcatccagccgtccctctgccacggttcagt
cgccacctgaacccctccgagcagggggatggcacaggcaccggaggcatgagtctcaga
ctgggagccaacacgcaggagccggagggaacgtatttggagaaagccgaagagctttac
tctctgatgtgtgctgtgacagacaagagtgtgtttggagatggggagaacacaaaggta
cgagtgtctgaactggaggaggaggtgaggaccctgaaaaagatcaataaagatctgtat
gagttctccactcagttgctcaccaaacccaactag

DBGET integrated database retrieval system