KEGG   Danio rerio (zebrafish): 449794
Entry
449794            CDS       T01004                                 

Symbol
h2ax1
Name
(RefSeq) H2A.X variant histone family member 1
  KO
K11251  histone H2A
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    449794 (h2ax1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    449794 (h2ax1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    449794 (h2ax1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    449794 (h2ax1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   449794 (h2ax1)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 449794
NCBI-ProteinID: NP_001005967
ZFIN: ZDB-GENE-041010-42
Ensembl: ENSDARG00000068995
Vega: OTTDARG00000008400
UniProt: Q5XJK2
Position
10:29816687..29817590
AA seq 128 aa
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKPAKSK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtctggaagaggtaaaaccggaggaaaggcccgcgcgaaggccaaatctcgttcatcc
agagctggacttcagtttccagtcggacgtgtacacagattgctacgcaagggaaattac
gccgagcgcgtaggcgcaggagcccccgtgtatttggccgctgtcctggagtacctgacg
gctgagatcctcgagctggccgggaacgcagcccgggacaacaagaaaacaagaattatc
ccccggcacctacagctggctgtccgaaacgacgaggagctcaacaagcttttaggcggc
gttaccatcgcccagggcggagtgctcccaaacatccaggcagtgctgctgcccaagaaa
accgagaagccagccaagagcaagtaa

DBGET integrated database retrieval system