KEGG   Danio rerio (zebrafish): 449801Help
Entry
449801            CDS       T01004                                 

Gene name
zgc:103601
Definition
(RefSeq) uncharacterized protein LOC449801
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00232  Caffeine metabolism
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    449801 (zgc:103601)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    449801 (zgc:103601)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     449801 (zgc:103601)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 449801
NCBI-ProteinID: NP_001005974
ZFIN: ZDB-GENE-041010-49
UniProt: Q5XJ69
Position
7
AA seq 288 aa AA seqDB search
MDLREYLNRIGFTGQFNKPDLDSLFTIHKLHVMSVPFENFSVHNGEKNSMDLHVIYNKIV
KSNRGGWCCENNLLFSWALKEMGYKSTILGGRVFNSLEQDFLPSDSHLINLVEIDGKQYI
ADVSFGMSYQIWYPLELISGKDQPQPPGVFRLTNNGEKWILQKTGRKQIIVDNGFVDSTL
VDKRLTKTLYSLTLTPRDADHFLEMSVMLQTNPDSLFLLKTICSLQTVTGYRALLGSTYS
EVTFKEDSDSVEMKKILDDEIEDVLKEKFNMVLVNKFTPKNQKADFRM
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggatctgagagagtacttgaacaggattgggtttactggccagttcaacaaacctgac
ctggacagtttgttcaccatccacaagctgcatgttatgagtgtcccatttgagaacttc
agtgttcacaatggggagaagaactcaatggacctgcatgtaatctataacaaaatagtc
aagagcaatcgaggaggctggtgttgtgaaaacaacctcttgttctcatgggccctaaag
gagatgggatacaaatctaccatattgggtggaagggtgttcaactctctggaacaggac
ttccttcctagtgactctcatctcatcaatctggtggagattgatggaaagcagtacatc
gctgacgtgagttttggtatgtcatatcagatctggtatcccttagagttgatctcaggt
aaagaccagccacagccaccaggagtgtttcgcctcacaaacaacggtgagaagtggatt
ctgcagaagaccggaaggaagcaaataattgtagataacggctttgtggattctaccctt
gttgacaaacggctcaccaagacattatactccctcacattaacaccacgtgatgcagat
catttcctggagatgtcggttatgctgcagactaatccagactctctcttcctgctcaag
accatttgctcccttcagacggtcactggctacagagctctgctcggctcgacatacagt
gaagtcactttcaaagaggactcagattcagtggaaatgaagaaaatcctagatgatgag
attgaggatgtgctgaaagaaaagtttaacatggtgttggttaataagttcacacctaaa
aaccagaaagctgatttccgcatgtag

DBGET integrated database retrieval system