KEGG   Danio rerio (zebrafish): 449819
Entry
449819            CDS       T01004                                 

Gene name
tmbim1a
Definition
(RefSeq) transmembrane BAX inhibitor motif containing 1a
  KO
K24205  protein lifeguard
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    449819 (tmbim1a)
SSDB
Motif
Pfam: Bax1-I DUF2371
Other DBs
NCBI-GeneID: 449819
NCBI-ProteinID: NP_001005992
ZFIN: ZDB-GENE-041010-69
Ensembl: ENSDARG00000058323
Vega: OTTDARG00000034589
UniProt: X1WGS1
Position
6
AA seq 332 aa
MSRSDFPPSYDDSRLLSNTQPGPGYPPSAPPYGFSPYEGQPGYPQPNDPYRGQPNDPYRG
QPNDPYRGQPNDPYRGQPAGYPPPAMPVIPVMPPPGIGDSEGFTTAEGFESTDVRHSFIR
KVYLILAAQLLVTAAVVAIFTFVEPVGLFVRKNPAIYWVSYAIYFVTHIVLVCCQGPRRR
FPWNLLLLAIFTLALSFMTGNIASYYSTRAVFLALAITVVVCVAVTVFCFQTKVDFTKCS
GFFCVLGIVVFVTGIITAIVLSFKYVPWLHMLYASIGAIAFTLFLAYHTQLLIGNRKLSI
SPEEYVFAALSLYVDIVQIFIFLLQIIGYAER
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtctagatcagatttccctccttcttatgatgattctcgactgctgtcaaacactcag
ccggggccaggttatcctccttctgctcctccatatggatttagtccatatgagggacaa
ccgggatacccacagcctaatgatccataccgaggacagcccaatgatccataccgagga
cagcctaatgatccataccgaggacagcctaatgatccataccgaggacagccggccgga
tacccccctccagctatgccagtcatccccgtcatgcctcctcctgggataggtgacagt
gaaggatttaccacagctgaaggattcgagagcactgatgtccggcacagttttatacgc
aaagtttatctgatcctcgctgctcagcttcttgtcactgctgccgtcgtggctattttc
acatttgtggaaccagtaggattgtttgtgaggaagaaccccgccatctactgggtttca
tatgccatctattttgtcacacatatagtactggtttgctgtcagggacccaggaggcgt
tttccatggaacctgctcctgttggccatttttacactggccttatctttcatgactgga
aatatagcaagttattacagcactagagcggtgttcctggccctggccatcacagttgtc
gtgtgtgtagcagtgactgtgttctgctttcagacgaaggtggacttcaccaaatgttct
ggctttttctgtgtactcggaatcgtagtgtttgtgaccggcatcatcactgctattgtc
ctgtcatttaaatatgtcccatggctacacatgctttatgcatctataggagccattgca
ttcactttgtttctggcctatcacactcagctgctcatcgggaaccggaagctctccatc
agcccagaagagtatgtgttcgctgctctctccctttatgttgacattgtgcagatcttc
atcttcctcctgcaaatcatcggttacgcagagagatag

DBGET integrated database retrieval system