KEGG   Danio rerio (zebrafish): 449848
Entry
449848            CDS       T01004                                 

Gene name
xrcc5
Definition
(RefSeq) X-ray repair cross-complementing protein 5
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    449848 (xrcc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dre03400]
    449848 (xrcc5)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     449848 (xrcc5)
SSDB
Motif
Pfam: Ku Ku_N Ku_PK_bind Ku_C VWA_2 VWA DUF2997 Peptidase_M57
Other DBs
NCBI-GeneID: 449848
NCBI-ProteinID: NP_001017360
ZFIN: ZDB-GENE-041008-108
Ensembl: ENSDARG00000099298
Vega: OTTDARG00000026118
UniProt: A0A0R4IB13
Position
9
AA seq 727 aa
MARAAKSALVLCMDVGFSMSNSGPGQEPPFEQAKKVIQKFVQRQVFAENKDEIGLVLFGT
DGTKNPLANDGQYENITVHRHLMIPDFELLEEIERELQPGGQQADWLDALVVCMDLLQNE
TMGKKYDRLNIALLTDLNIQTSEDQLDIIIQNLKKAGITLQFFLPFPVDVEDEAGGGGDA
AGPSAPPSRPGKGLSRQQTQGLEMVKHIMSSLEDEDGLEEVYTFSDALEKLSIFKRIERR
PMAWPCQLTIGSSLSIRIVGYKAVTEEKVKKSWTIVDAQSHQRDDVKRETVYCLNDDDET
EVQKDDTIQGYRYGSDIVPFSKVDEEQMKYKHDGKCFSVLGFTKQELIPRHQFMGSQVVK
VFAPRDDEHAAVALSSLIRALDGLKMAAIVRYAYDRRSNPQVGAAFPCIKKKYECLLYVQ
LPYMEDLRQFTFPMLENNKKFMPSGSQLSAVDALIDSMMLMEKDENGESVEIFKVNHIPN
PQFQRLFQCLHHRGVNPDDPLPPVDPWLKRVLERPQAVSARCQAPLRDVKTSFPLKVVVK
KKEQKTSADVFGSSADEPDAKKVKVNEETEFNLAEITEGNITSVGSVNPARDFCTLIRQK
TVSFDQACQQLTHRIEQLLGNRSTEYYTKSIACIQAFRDQSVLSGNAELFNSYLQSLKRS
IADRSLQDFWNLLAQDALTLISKDEVEASTISKQEANQFLSFEQKQEVEVAPAQDDTGDV
DDLLDMM
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcgcgagcagcgaagtcagcgctggtgctctgcatggatgtgggtttctccatgagc
aactctggacctggacaggagccgccatttgaacaggccaagaaagtcatccagaagttt
gtccagcggcaggtgtttgctgagaataaggatgagattggtttggtgctgtttggtact
gatggcaccaagaatcctctggccaatgacggtcagtatgagaacatcacggttcaccga
cacctcatgatccctgattttgaactgctggaggagattgagagagaactgcaacctggc
ggtcagcaggcagactggctcgatgctctggtggtttgcatggaccttctgcagaatgaa
accatggggaagaagtatgatcgtctgaacatcgccttgctgacggatctgaacatccag
acttcagaagatcagctggatattatcattcagaacctgaagaaagctggaatcaccctg
cagttttttttgccgttccctgtggatgttgaggatgaagccggaggtggaggtgatgca
gcaggaccctcagcgcctccgtcccgtccaggaaaaggcttgagtcgccaacaaacacaa
ggcctggagatggtcaaacacatcatgagcagcctggaggacgaggacggcctggaggag
gtctacacattcagtgacgctctggagaaactctccatcttcaagcgtattgaaaggagg
ccgatggcatggccgtgtcagctcaccatcggcagctctctgtctattcgcattgttgga
tataaagctgtgacagaggaaaaggtgaaaaagtcttggacgattgtggacgctcagagt
caccagagagatgacgtgaagagagagacagtttactgtctgaacgatgatgatgaaact
gaggtgcagaaagacgacacaatacaaggttaccgttatggaagtgacattgtgccgttt
tcaaaggtggacgaggagcagatgaaatataagcatgatgggaagtgtttctctgtgctt
ggcttcactaaacaggagctgattcctcgtcatcagtttatgggaagccaagttgtcaaa
gtctttgcacccagagatgatgagcatgcagcagttgctctgtcctctctgattcgtgct
cttgatggtctaaagatggcagccattgtacgttatgcttacgaccgccgcagcaatcct
caagtgggcgccgcgtttccctgcataaagaaaaaatatgaatgtctgctgtacgttcag
ctgccgtatatggaggatctccgtcagttcactttccccatgctggaaaacaacaagaag
tttatgccatcagggtctcagttgtcagccgtagatgcgctgatcgactccatgatgctg
atggagaaggatgagaatggagaaagtgtggagatcttcaaagtcaaccacatcccaaac
ccacagttccagaggctcttccagtgtttgcatcaccgcggtgtgaatcctgatgatcct
ctgcctcccgtggatccgtggctcaagcgggtcctggaaagaccgcaggccgtgtccgct
cgctgccaggcccctctgcgggacgtcaagaccagcttccctctcaaagtggtggtgaaa
aagaaagagcagaagacgagcgcagacgtgttcggcagcagtgctgatgaaccagatgcc
aagaaagtcaaagtgaatgaagaaaccgagtttaacctggctgagattacagagggaaac
atcacatcggttggcagcgtcaatccagccagagatttctgcacactgataagacagaag
acggtttctttcgatcaagcgtgccagcagctgacccacaggattgagcagttgctgggc
aacaggagcactgagtattacaccaagagcatcgcctgcatccaggccttcagggatcag
tctgtactgagcggaaacgcagagctgttcaacagttacctgcagtctctgaagaggagc
attgctgaccgcagccttcaggacttctggaacctgctcgctcaagatgctctaacgctg
attagcaaagatgaagtggaggcaagcaccatctccaaacaagaagcaaatcagttcctg
tcatttgagcagaagcaggaagttgaagtagctccagcgcaggacgacactggagatgtg
gatgatctgctggacatgatgtaa

DBGET integrated database retrieval system