KEGG   Danio rerio (zebrafish): 474325
Entry
474325            CDS       T01004                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre00240  Pyrimidine metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    474325 (dck)
   00240 Pyrimidine metabolism
    474325 (dck)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     474325 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 474325
NCBI-ProteinID: NP_001007057
ZFIN: ZDB-GENE-041024-3
Ensembl: ENSDARG00000044807
Vega: OTTDARG00000034867
UniProt: Q5XJM2
Position
21
AA seq 263 aa
MSPTAKRACPSPLNDSLEKRLKRISIEGNIAAGKSTFVRLLEEHDREWEVVPEPIARWCN
VQTQHDDHEELTTSQKSGGNVLQMMYEKPERWAYTFQSYACMSRIRSQIKSTNGKLREAE
NPVQFFERSVYSDRYIFASNLYESECVNETEWAIYQDWHSWLHKQFGKHIELDGIIYLRA
KPERCLERLHLRGREEEQGIPLEYLEKLHYKHECWLQHRTMSMDFDYLNDVPVLTLDVND
DFKDNNMMCADMIEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtctccaacagccaagagagcctgtcccagtcctctgaatgacagcctggagaaaaga
ctcaagcgcatctccattgaaggcaacatcgcggcgggtaaatccacttttgttcgcctg
ctggaggagcatgatagagaatgggaggttgtaccagaacccatcgctagatggtgcaat
gtacaaactcaacacgacgaccatgaggagctgaccacgtctcagaagagcggaggaaac
gtgctgcagatgatgtacgagaagccggagcgctgggcctacaccttccagagctacgcc
tgcatgagccgcatccgctcgcagatcaaatccaccaacggcaagctgagagaggccgaa
aatccggtgcagttcttcgagagatccgtctacagcgacaggtacatcttcgcctctaac
ctgtacgagagcgagtgtgtgaacgagactgagtgggccatctatcaggactggcacagc
tggctgcataagcagttcgggaagcacattgagctggatggcatcatttacctgagggcg
aagccagagaggtgtttggagcgactgcatctaagaggaagagaggaggagcagggcatt
cctttggagtatctggagaaactgcattataaacatgagtgctggttacagcacagaacc
atgagtatggactttgattatctgaatgatgtgcccgttctcaccctggatgtcaatgat
gattttaaagacaacaacatgatgtgcgctgatatgattgagaaggtaaaggagtttctg
agcaccctgtga

DBGET integrated database retrieval system