KEGG   Danio rerio (zebrafish): 492493
Entry
492493            CDS       T01004                                 

Gene name
tnni2a.1
Definition
(RefSeq) troponin I type 2a (skeletal, fast), tandem duplicate 1
  KO
K12043  troponin I, fast skeletal muscle
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    492493 (tnni2a.1)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     492493 (tnni2a.1)
SSDB
Motif
Pfam: Troponin Tup_N Spc42p Chitin_synth_1N DUF2730 YlqD DUF2408
Other DBs
NCBI-GeneID: 492493
NCBI-ProteinID: NP_001007366
ZFIN: ZDB-GENE-041114-60
Ensembl: ENSDARG00000045592
Vega: OTTDARG00000028474
UniProt: Q5U3E9
Position
25
AA seq 178 aa
MSEKKMSSSRKHHLKSLMLSIAKGLLEQEVNDREVERERYMAETCQPLSLPGSMQALQEL
CRDLHRKIDVIDEERYDLEMKVNKCAKEIEDLNIKVIDLKGKFKKPTLRKVRMSADQMLQ
ALLGSKHKVSLDLRANLKQVKKEVKEEDKELRDVGDWRKNVEDKAGMDGRKKMFEAEA
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtcggagaaaaagatgtcatcgagtcgcaagcatcatctaaagagcttgatgctctcc
atcgctaagggtttactggagcaggaggtaaatgacagagaggtggagagggagagatac
atggcagaaacctgtcagcctctttccctacctgggtccatgcaggcattacaggaactg
tgcagagatcttcatcgaaaaattgatgtgattgatgaggaaagatatgatctggaaatg
aaagtcaacaaatgtgcaaaggagatcgaagacctgaatatcaaagttattgacctgaag
ggcaagttcaagaagccaacgctgaggaaagtgcgcatgtctgccgatcagatgcttcag
gctctgctgggctccaaacacaaggtctctctggacttgagagcaaacctgaaacaagtc
aagaaggaggtcaaagaggaggataaagaactgcgtgatgttggtgactggcgtaaaaat
gttgaagacaaggctggcatggacggcaggaagaagatgtttgaagctgaggcttaa

DBGET integrated database retrieval system