KEGG   Danio rerio (zebrafish): 494054
Entry
494054            CDS       T01004                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase TM7SF2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00100  Steroid biosynthesis
dre01100  Metabolic pathways
Module
dre_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    494054 (tm7sf2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     494054 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 494054
NCBI-ProteinID: NP_001008597
ZFIN: ZDB-GENE-041212-19
Ensembl: ENSDARG00000032816
Vega: OTTDARG00000031067
UniProt: Q5PR41
Position
10
AA seq 421 aa
MKPNKHKASHSAEREFGGALGATCIPVFLPLTVLYLLSVCRSPAASVLQWPPPLPPATHL
WDPWAAVLIAGWIALQSFLYLLPIGKVSEGLVLRDGSRLKYPINGFHALSITAVLLIICI
LLGMPLGHLFELILPLAICAIGVSYLLSMYLYIRSFWAHQHALSLGGNTGNPLYDFFMGR
ELNPRIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRDSPSLAMLLINGFQLLYVTDA
LWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYSLQAMFLVVHPQSLSTLGAVGIVLLN
GIGYYIFRRSNSQKNQFRRDPKHKSVAHLETIATATGKRLLVSGWWGFVRHPNYLGDLLM
ALAWSLPCGISHILPYFYVIYFTILLIHREARDEKQCRAKYGVAWDTYCRRVPYRIIPYV
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaagcctaacaagcacaaagcatcacattcagctgaaagggaatttggaggtgctctt
ggtgccacctgcattccagtgttcctgcctctgacagttctgtacctgctcagtgtgtgc
cggtctccagctgccagtgtcctgcagtggcctcctcctctaccacctgctacacattta
tgggatccgtgggctgctgttcttattgcaggttggattgccctgcagagttttctctac
ctactgcctatagggaaggtttctgaaggtttggttctcagagatggatccagactgaaa
tatcccattaatggtttccatgccctgagcattactgctgttctgttgatcatatgtatt
ttgctgggaatgccactcgggcacctgtttgagctcattttgcctctggctatatgtgcc
attggagtttcctatctactgtcaatgtatctgtacatccgctccttctgggcacatcaa
catgctttatcacttgggggaaacacaggaaatcctctgtatgacttcttcatgggtcga
gagctcaaccctcgcattggaaactttgacttgaaatatttctgtgaactaagacctgga
ttaataggctgggtggtcataaacctagggatgctaatgaaagaagtagagctgcgcgac
tctccatctcttgccatgctgctcatcaatggatttcagctcctctacgtgacagatgct
ctctggaatgaagaggccgttcttactacaatggatattgtgcatgatggatttgggttc
atgttggcgtttggtgatctggcctgggttcccttcacgtatagtcttcaggccatgttt
ctggttgttcacccacagtcacttagtactcttggtgccgtggggattgtgcttctaaat
ggaattggctattacattttcaggaggtccaactctcagaaaaatcagttcagaagagac
cccaagcataaaagtgtagcacacctggaaactatcgcgacagcaacaggaaagcggctg
ttggtatcaggatggtggggttttgtcagacatccaaactacctgggtgaccttctgatg
gccctagcctggtccctgccttgtggaatatcccacattctgccttacttctacgtcata
tatttcactattctgctcatccaccgagaagccagagatgagaaacaatgccgagccaaa
tacggagtggcctgggacacttactgcagacgagtgccctacagaataatcccctatgtt
tattaa

DBGET integrated database retrieval system