KEGG   Danio rerio (zebrafish): 494076Help
Entry
494076            CDS       T01004                                 

Gene name
dhtkd1
Definition
(RefSeq) probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
  KO
K15791  probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 [EC:1.2.4.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
dre00380  Tryptophan metabolism
dre01100  Metabolic pathways
Module
dre_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    494076 (dhtkd1)
   00380 Tryptophan metabolism
    494076 (dhtkd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dre03029]
    494076 (dhtkd1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     494076 (dhtkd1)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    494076 (dhtkd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C
Motif
Other DBs
NCBI-GeneID: 494076
NCBI-ProteinID: NP_001008619
ZFIN: ZDB-GENE-041212-44
Ensembl: ENSDARG00000016415
Vega: OTTDARG00000039264
UniProt: Q5PRA2
Position
25
AA seq 925 aa AA seqDB search
MSARSMLIHLPRLLHRSFGARRSFLASLYHTQRGVYGFRPRDGPERRAELTQISALNRDH
GLARLVEAYRAHGHKVAKINPLLPQSPVLESVPEISLLNGAVRGVLNTTGLRHFGKAEAT
AEEVVAYLESTYCGGISVETSQLQTLEEREWFADRFEELKKEAFSPEERRMLAKLMLESQ
EFDHFLATKFATVKRYGGEGAESMMGFFYELFRSSVYSGVTDVVMGMPHRGRLNLLTGLL
QFPPELMFRKMRGLSEFPEHSPSIGDVLSHLTSTVELDFGAGHPLHVTMLPNPSHLEAIN
PVTQGKTRGRQQVKQDGDYSTDPHSRPGDKVICLQVHGDASFSGQGIVPETFTLSNLPHY
RVGGSIHLIVNNQVGYTTPSERGRSSLYCSDVGKMVGCAIIHVNGDDAEEVLRATRLAVE
YQRRFRKDVIVDLLCYRQWGHNELDEPFFTNPAMYKIIRSRKSIPDSYADQLISEGLMTD
EERSQIKTSYYATLNNQLTNMTLYSPPPTNLQGRWGDLVEPQNRVSCWDTGVAQPLLQFV
GAKSVDIPEEIILHSHLRKTHVQARLQKLEEGTKLDWSTAEALAFGTLLCQGFNIRISGQ
DVGRGTFSQRHAMVVCQETNDMFIPLNHISSEQKGHLEVCNSALSEEAVLGFEYGMSIAQ
PRLLPIWEAQFGDFFNGAQIIFDTFLSGGEAKWLLQSGLVILLPHGYDGAGPEHSSCRIE
RFLQLCDSKEEGVDGDTVNMAVVNPTLPAQYFHLLRRQMIRNFRKPLIVASPKTLLRFSG
AVSGLSDMGPGTSFKPIIGDSSVNPASVQRVLFCSGKHYYALLKHRETIPEAEKNTALVR
VEELCPFPTEALQQELNKYTNAKEFIWSQEEPQNMGCWSFVSPRFEKQLACKLRLVSRPA
LPAPAVGIGTLHHQQHEAILTSSFS
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgcgcagtatgcttatacacctccctcggcttttgcaccgctcctttggtgcc
aggaggtcgtttttagcgagtttgtaccacactcagcgtggtgtgtacggtttcagaccg
agagacggtccagaaagacgggcagagttaacgcagatctccgctcttaaccgagatcac
ggactggcgagactggtggaggcctatcgagcacatggacacaaagtagctaaaattaac
cccttactaccacaaagtcccgtgctggagagtgtaccggagataagcctgctgaatgga
gctgttcgtggagtcctcaacactaccgggttgcggcactttggtaaagctgaggcgact
gcagaagaggttgtggcgtatctggaaagcacatactgtgggggaatctcagtggaaacc
tctcagctgcagaccttagaggaacgagaatggttcgctgaccgatttgaggagctcaaa
aaagaggcgttttctccagaggaaaggagaatgctggctaaactgatgctcgagtcacag
gaatttgaccactttttagccaccaagtttgcaactgtgaagcggtatggaggcgaggga
gcagagagcatgatgggatttttctacgagctgtttcgctcttcagtatacagtggagtg
acggatgtggtcatgggaatgcctcaccgcggacgccttaatctgctcaccggccttctt
cagtttcctcctgagctcatgtttcgtaagatgaggggtctcagtgagtttccggagcac
tctccctctatcggagacgtcttgtcccatttaacgtctacagtggagcttgacttcggg
gcaggacaccctctccatgtcacaatgctgcccaatccttcccacctggaggccatcaac
cctgtgacacaggggaaaacacgaggccgacagcaggtcaaacaggacggcgactactcc
actgaccctcattcacgaccgggagacaaagtcatctgcctgcaggttcatggcgatgct
tcattttcaggacaaggaatagtaccggaaaccttcaccttgtcaaatctccctcattat
agagtgggtggaagcatccacctcattgtaaacaatcaagtgggctacaccactccctct
gagaggggaagatcatctctctactgtagtgatgttggtaaaatggtgggatgtgcaata
atccatgtgaatggcgatgatgctgaagaagtcctcagagcgacccggctggcggtggag
taccagagacgcttcagaaaagacgtcattgttgatctgctttgttaccggcagtggggc
cacaatgagctggacgaaccctttttcacaaaccctgcaatgtataaaataatacggtca
agaaaaagcatcccagattcctatgctgaccagctgatctctgagggtctgatgacagac
gaggagcgcagtcagatcaagaccagctactacgctacgctcaacaaccagctgactaac
atgaccctctacagccctccacccacaaacctgcagggccgctggggagacctggtggag
ccccagaatagagtctcgtgctgggacactggcgtcgcacagcccctgctgcagtttgtt
ggagccaaatcagtggacatacctgaggagatcattctgcacagtcacctgaggaagaca
cacgtgcaggcacgtctgcagaaactagaagagggcacaaaattggactggtccaccgcg
gaggctctggcgtttggcacattgctatgccagggatttaatatccgtatcagtggtcag
gatgtgggtcggggaacgttcagtcagcgccacgctatggttgtgtgtcaggagaccaac
gacatgttcatcccactcaatcacatcagctctgaacagaagggccacttggaggtgtgt
aacagtgctctctctgaggaagcggttctgggttttgagtatgggatgagcattgctcag
cctcgactgctgcccatctgggaggctcagtttggagatttcttcaacggtgcccagatt
atttttgatactttcctctctggaggtgaggctaaatggctcctgcagagtggactggtc
attttactgccacacgggtacgatggggccggtcctgagcattcatcttgccgaatcgag
cgcttcttacagctctgcgacagtaaagaggaaggtgtggacggggacacggtcaacatg
gcggtggtgaatcccacacttccagctcaatacttccatcttttgaggaggcagatgatc
agaaacttccggaaaccgctgatcgtggcctctcccaagactctgctgcgcttttctggg
gcagtgtcaggcttgtctgatatgggaccaggaacgtcctttaagccgattattggtgat
tcttctgtgaaccctgcaagtgtgcagcgggttctgttttgctcaggtaaacattactat
gccctgctgaaacacagagagacgatacctgaggcggaaaaaaacacagcgctagtcagg
gtcgaggaactgtgtcctttccccacagaagctctgcaacaggaactaaataaatacaca
aacgccaaagagttcatctggagtcaagaggagccacagaacatgggctgctggtcattt
gtgtcaccgaggtttgaaaaacagttagcctgcaagttgcggttggtcagcagacccgca
ttacccgctccggctgtgggcatcggaacgcttcaccatcagcagcatgaagccatcctg
acttcgtctttctcctga

DBGET integrated database retrieval system