KEGG   Danio rerio (zebrafish): 494112Help
Entry
494112            CDS       T01004                                 

Gene name
cdk20
Definition
(RefSeq) cyclin-dependent kinase 20
  KO
K08817  cell cycle related kinase [EC:2.7.11.22]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    494112 (cdk20)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     494112 (cdk20)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  CDK family
   494112 (cdk20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 494112
NCBI-ProteinID: NP_001008655
ZFIN: ZDB-GENE-041212-84
Ensembl: ENSDARG00000003867
Vega: OTTDARG00000020616
UniProt: A8WIP6 B2GQ42
Position
8
AA seq 261 aa AA seqDB search
MLSDLSEVIRNSQRPLTASQVKSYMMMLLKGVAFCHENSIMHRDLKPANLLISSTGHLKI
ADFGLARLFSNEGDRLYSHQVATRWYRAPELLYGARKYDEGVDLWAVGCIFGELLNNSPL
FPGENDIEQLCCVLRVLGTPNQKVWPEITELPDYNKITFKENPPIPLEEIVPDTSPQAVD
LLKKFLVYPSKQRISARQALLHPYFFTDPLPAHHSELPIPQRGGKHSRQRMQPPHEFTVD
RPLHESVVDPSLIQKHAMSCS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagatctgtcagaagtcataaggaattcccagcgtcctctcaccgcatcccag
gtcaaaagttatatgatgatgctgctgaaaggagtggctttctgccacgagaactccatc
atgcatagggatctgaagcctgcaaaccttctgatcagctcgactggtcatctgaaaatc
gctgactttggtctggcaaggcttttttccaatgaaggagatcgtctctacagtcaccaa
gttgccaccagatggtacagagcaccagaacttttatacggtgcccgaaaatatgacgaa
ggagttgatctctgggctgtgggctgcattttcggagagcttttgaataactctccactt
ttccctggggagaatgacattgaacagttgtgttgtgtgctcagagtgctgggaactccc
aaccagaaagtctggccggagataaccgaactaccagactacaacaagatcacatttaaa
gaaaacccacccattcctttggaggagatcgtacctgacacgtcaccacaagctgtagac
ctgctgaagaagtttctggtctatccatccaaacagaggatcagtgctagacaggctttg
ctccatccatatttcttcacggatccgctcccggctcatcattcagagctgcccattcct
cagcgtggaggaaaacactccagacagcgcatgcagccgccgcacgagttcaccgtcgat
cggcctttacacgagagcgtggtggacccgagtctcatccagaagcatgccatgagctgt
tcatga

DBGET integrated database retrieval system