KEGG   Danio rerio (zebrafish): 503516
Entry
503516            CDS       T01004                                 

Gene name
blf
Definition
(RefSeq) bloody fingers
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf_UBZ Zn-ribbon_8 zf-C2H2_jaz zf-C2H2_11 C1_1 zinc_ribbon_15 zf-C2HE zf-H2C2_5
Other DBs
NCBI-GeneID: 503516
NCBI-ProteinID: NP_001012503
ZFIN: ZDB-GENE-050721-1
Ensembl: ENSDARG00000043126
UniProt: Q5J2I5
Position
22
AA seq 478 aa
MSDPETSIMDQEDLSDLMEESEESEEMSEVEKKRRHVKTPKTSQTKSAQKTFKCPQCGKK
FARKSGLTAHVKIHTGEKPFSCKECGKSFSSSGYIKRHMIIHSGEKPHTCDQCGKSFGLA
SSLKSHAAVHSEEKPFKCDHCGDSFRWLSSLRDHLKTHGKKETHVCSVCGKSFAQLILLK
KHKKRHEVKNFMCFECGKTFVRNCELKQHQRVHTGEKPYKCSHCDKRFSNGSSKVVHERI
HTGERPYSCDQCGHAFRHTHALESHKRIHTGEKSYTCDQCGKSFTQKASLRIHKKFHNAE
KPHTCDQCGKSFTLKTSLNEHMKIHTGEKPHTCDQCGKRFSRLSLLKLHLATHSVIRPYR
CEKCGKGFTWESCLKNHLKTHSEEKPHKCSVCGKGFRLANSLRSHQKRHTGVKNHMCFDC
GKTYFTKNELKLHQKVHSGGEFYKCLHCDMTFKRLDYVKNHEKTHTVRSDPSESSEED
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagtgatccagaaaccagcataatggaccaagaagacctaagtgatctgatggaagag
agcgaggagagtgaagaaatgagtgaagtggaaaagaagcggcgtcatgtcaaaacacca
aaaacatcacaaactaaaagtgcccaaaagactttcaagtgtcctcagtgtgggaagaaa
tttgcacgaaaaagtggccttactgctcacgtgaaaatccacactggagagaaaccgttc
tcgtgcaaagagtgtgggaagagtttttcgagtagcggatacattaagagacacatgatc
attcactccggagagaagccgcacacgtgtgatcagtgcggtaaaagttttggacttgca
agtagccttaaatcccacgctgcagttcattctgaagaaaaaccattcaagtgtgatcat
tgcggtgacagttttcgttggttatctagtctgagggaccacctgaaaactcatggcaag
aaagagactcacgtgtgttctgtgtgcggaaagagctttgctcaattgattcttttaaaa
aaacacaagaaaagacacgaagtgaagaacttcatgtgttttgagtgcgggaagaccttt
gtaagaaattgtgaactgaaacagcaccagagagttcacaccggagaaaaaccgtacaag
tgttcacactgtgacaagagattcagtaacggatcgtctaaagtagtacatgagaggatc
cacactggagaaaggccgtactcgtgtgatcaatgtgggcacgcgtttagacacacacac
gccctcgagtctcacaagcgaatccacacgggagagaaatcatacacttgtgatcaatgc
gggaagagttttacacaaaaagcaagccttagaattcacaagaaatttcacaatgcagag
aaaccgcacacatgcgatcaatgcgggaagagtttcacacttaaaacaagccttaatgaa
cacatgaagatccacactggagagaagccgcacacgtgtgatcagtgcgggaagagattc
agtaggttaagcttgcttaaattacatctggccacccattctgtaatcagaccatatcgc
tgtgagaagtgcggcaaaggctttacttgggaatcatgcctgaagaaccacctgaaaact
cattcagaggagaagcctcataagtgctccgtctgcggtaaaggtttccgtctggcaaat
agtttacgatcacaccagaaaagacacaccggtgtaaagaatcacatgtgctttgattgt
gggaagacctattttacgaagaatgaactgaagctgcaccagaaagttcattcaggagga
gagttctacaagtgtttacactgcgacatgacattcaagcggttagattatgtgaaaaac
cacgagaagacccacactgtgaggagcgatccatctgaaagctcagaagaggattaa

DBGET integrated database retrieval system