KEGG   Danio rerio (zebrafish): 541549
Entry
541549            CDS       T01004                                 

Gene name
zgc:113343
Definition
(RefSeq) uncharacterized protein LOC541549
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 zf_UBZ zf-LYAR zf-C2HE Zn-ribbon_8 zf_C2H2_ZHX HypA Zn_Tnp_IS1595 zinc_ribbon_15 DUF2256 LIM Siva zf-C2HC_2 C1_4 Rpr2
Other DBs
NCBI-GeneID: 541549
NCBI-ProteinID: NP_001014384
ZFIN: ZDB-GENE-050327-90
Ensembl: ENSDARG00000103196
Vega: OTTDARG00000022626
UniProt: Q58EF6
Position
21
AA seq 356 aa
METEEEPCRIKEEETEEQIDADENAVSSQTEDTSRPKQAGRTAVEGSFICSECGKSYKSK
DSLYRHTRFHSGQGLFTCTQCGKDFVQKGQLDKHMRIHTGERPYACSQCGKSYNDAATLK
MHTKTHSGEKPFTCIQCGKSFIYRKTLKDHQLSHNAVKPFSCDQCSKAFTLEKYLRQHLH
VHAAVKPYVCFCGKSYTTMNMLNEHQRIHTGEKLYQCSHCAKNFTYSNSLKVHQRIHTGE
KPYRCSSCGKSFTQLASLKAHQRIHTGVKPYVCSDCGKSFSTSSSLTAHRRIHTGEKPYQ
CSHCGKSFNRTGGLKDHQKVHTGEKPHQCSSCGKSFTQMSNLRVHIEKIHSPKLLE
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggagactgaggaagaaccctgcagaataaaggaggaagagacagaggaacaaatagat
gcggatgaaaatgcagtcagttcacagactgaagacacttccagaccaaaacaagctgga
agaactgcagtcgaaggatctttcatctgctccgagtgcggaaagagttacaaaagcaaa
gacagtctttacagacacacaagatttcactctgggcaaggcctgttcacatgcactcag
tgtggcaaggattttgttcagaaaggacagcttgataaacacatgaggattcacaccgga
gaaaggccgtatgcatgctctcaatgtggaaagagttacaatgacgccgctacattgaaa
atgcacacgaagacgcacagcggagagaaaccgtttacgtgcattcaatgtggaaagagt
ttcatatataggaagactctaaaggatcatcagctctctcacaatgcggtaaagccattc
agctgtgatcagtgcagcaaagcatttacattagaaaaatacttaagacaacatcttcat
gtgcacgctgccgtgaagccctacgtctgcttctgtgggaaaagttatacgacaatgaac
atgttaaatgagcaccagaggattcacaccggagagaaactgtatcagtgctcacactgt
gcaaagaacttcacttactcaaactccttgaaagttcaccagaggattcacactggagaa
aagccctatcggtgctcttcatgcgggaagagtttcactcagttagcaagcttgaaagct
catcagaggattcacactggagtcaaaccctatgtgtgttcagactgcgggaagagcttt
agtacatcgagcagtttaactgcacaccggaggattcacactggagagaaaccgtatcag
tgttcacactgtggaaagagtttcaatcggacaggaggcctgaaagatcatcagaaagtt
cacactggggagaaaccacaccagtgctcctcgtgtggaaagagtttcactcaaatgtct
aatctgcgggttcatattgaaaaaattcacagcccaaagttgcttgaataa

DBGET integrated database retrieval system