KEGG   Danio rerio (zebrafish): 550134Help
Entry
550134            CDS       T01004                                 

Gene name
ubb
Definition
(RefSeq) polyubiquitin-B
  KO
K08770  ubiquitin C
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    550134 (ubb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    550134 (ubb)
Ubiquitin system [BR:dre04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   550134 (ubb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 550134
NCBI-ProteinID: NP_001013290
ZFIN: ZDB-GENE-050411-10
UniProt: Q6IS68 A0A0N4SUD2
Position
5
AA seq 610 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGSD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgtcaaaacccttactggtaagaccatcaccctcgaggtagagccaagt
gacaccattgagaacgtcaaggccaaaatccaggacaaagaaggcattccccctgaccag
cagaggttgatctttgctggcaaacagctagaagatggccgcaccctgtccgactacaac
atccagaaagagtccaccttgcatctggtgctgcgtcttagaggaggcatgcagatcttt
gtaaaaaccttgacaggaaagaccataaccctcgaggtagagccaagcgacaccattgag
aatgtcaaggccaaaatccaagacaaagaaggcattccccctgaccagcagaggttgatc
tttgctggcaaacagctagaagatggccgcaccctgtccgactacaacatccagaaagag
tccaccttgcatctggtgctgcgtcttagaggaggcatgcagatctttgtaaaaaccttg
acaggaaagaccatcaccctcgaggtagagccaagcgacaccattgagaatgtcaaggcc
aaaatccaagacaaagaaggcattccccctgaccagcagaggttaatctttgctggcaaa
cagctagaagatggccgcaccctgtctgactacaacatccagaaagagtccaccttgcat
ctggtgttgcgtctcaggggagggatgcagatcttcgttaagaccttgacaggaaagacc
atcaccctcgaggtagagccaagtgacaccattgagaacgtcaaggccaaaatccaagac
aaagaaggcattccccctgaccagcagaggttgatctttgccggcaaacagctagaagat
ggccgcaccctgtctgactacaacatccagaaagagtccaccttgcatctggtgctgcgt
ctcaggggaggcatgcagatcttcgttaagaccttgacaggaaagaccataactctcgag
gtagagccaagcgacaccattgagaacgtcaaggccaaaatccaagacaaagaaggcatt
ccccctgaccagcagagattgatttttgctggcaaacagctagaagatggacgcaccctg
tccgactacaacatccagaaagagtccaccttgcatctggtgttgcgtctcaggggaggc
atgcagatctttgtaaaaaccttgacaggaaagaccatcaccctcgaggtagagccaagc
gacaccattgagaatgtcaaggccaaaatccaagacaaagaaggcattccccctgaccag
cagaggttgatctttgccggcaaacagctagaagatggccgcaccctgtctgactacaac
atccagaaagagtccaccttgcatctggtgctgcgtctcaggggaggcatgcagatcttc
gttaagaccttgacaggaaagaccataactctcgaggtagagccaagtgacaccattgag
aacgtcaaggccaaaatccaggacaaagaaggcattccccctgaccagcagaggttgatc
tttgctggaaaacagctagaagatggacgcaccctgtccgactacaacatccagaaagag
tccaccttgcatctggtgttgcgtctcaggggaggcatgcagatttttgttaaaaccttg
acaggaaagaccatcaccctcgaggtagagccaagtgacaccattgagaacgtcaaggcc
aaaatccaagacaaagaaggcattccccctgaccagcagaggttgatctttgctggtaaa
cagctagaagatggccgaaccctgtctgactacaacatccagaaagagtctactttgcac
cttgtgctgcgtctccgaggaggctcagattag

DBGET integrated database retrieval system