KEGG   Danio rerio (zebrafish): 550266
Entry
550266            CDS       T01004                                 

Gene name
acer1
Definition
(RefSeq) alkaline ceramidase 1
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00600  Sphingolipid metabolism
dre01100  Metabolic pathways
Module
dre_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    550266 (acer1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     550266 (acer1)
SSDB
Motif
Pfam: Ceramidase Acyltransf_C
Other DBs
NCBI-GeneID: 550266
NCBI-ProteinID: NP_001017603
ZFIN: ZDB-GENE-050417-70
Ensembl: ENSDARG00000010347
Vega: OTTDARG00000022177
UniProt: Q568I2 B2GQ52
Position
8
AA seq 266 aa
MAGVFSYESSEVDWCEDNYKHSENVVEYFNTMSSFIFFVISPIMLYLLHPYAKERNLAVH
LVWIMMVFVGIFSMYFHMTLSFMGQMLDELSILWVLAIGYSLWFPRKHFPSFVKDRTSFA
RLVLTITIISTLSSFVKPTANAYALNCFAIHILYSLFVELKSCTDERVLRLAWASIGLWV
LAISCWISDRFGCSFWQKLDFCYLHGIWHILIVMATAYASTLIAYLDASQEIPYSLPDLQ
YWPRNNWAIGLPYIVLKGTNTTRKTC
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcaggcgtgttttcctacgagagctctgaggtggactggtgtgaggacaactataaa
cattcggagaatgttgtggaatatttcaacacgatgagcagtttcatcttctttgtgatc
tcacctataatgctgtacctgctacacccgtatgccaaggaaaggaacctggctgtgcat
ctggtctggatcatgatggtgtttgtaggtatcttctccatgtatttccacatgactctg
agttttatgggccagatgctggatgagctgtccatcctgtgggttttggctattggttac
tcgctgtggtttccccgcaaacacttcccttccttcgttaaggacaggacatctttcgct
cgtttggtgctgaccatcactatcataagtactctgtcatcttttgtcaaacctacagcc
aatgcctacgctctcaactgcttcgccatccatatcctctactctctgtttgtggagtta
aagagttgcacagatgagcgagtgctgcgtctggcctgggcctccattggcctgtgggtt
ctggccatctcatgctggattagcgatcgctttggctgcagcttctggcagaaactggac
ttctgttatctgcacggtatctggcacattttgattgtaatggccactgcttatgctagc
actttgattgcatacctggatgctagtcaggagatcccttattccctcccggacttgcag
tactggccccggaataactgggccattgggctgccatacatcgtcctcaaaggcaccaat
acgacccggaaaacatgctag

DBGET integrated database retrieval system