KEGG   Danio rerio (zebrafish): 550457
Entry
550457            CDS       T01004                                 

Symbol
rab3ab
Name
(RefSeq) RAB3A, member RAS oncogene family, b
  KO
K07882  Ras-related protein Rab-3A
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    550457 (rab3ab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    550457 (rab3ab)
   04031 GTP-binding proteins [BR:dre04031]
    550457 (rab3ab)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    550457 (rab3ab)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   550457 (rab3ab)
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    550457 (rab3ab)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 GTP_EFTU Gtr1_RagA CPT AAA_24 AAA_16 Septin DUF2757
Other DBs
NCBI-GeneID: 550457
NCBI-ProteinID: NP_001017761
ZFIN: ZDB-GENE-041210-268
Ensembl: ENSDARG00000043835
Vega: OTTDARG00000011004
UniProt: Q5RGB5
Position
11
AA seq 220 aa
MASATDNRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVASERGRQLSEHLGFEYFEASAKDNINVKQTFERLV
DIICEKMSESLDAADPAVTGAKQGPQLTEQPAAPHQDCAC
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcttcagctacagacaaccgttatggacaaaaggagtcttctgaccagaactttgat
tacatgttcaaaatcctaatcatcgggaatagcagcgttgggaagaccagctttctgttt
cgttatgcagacgactccttcacgccagcgttcgtaagcacggtcggcatcgacttcaag
gtgaagaccatctacaggaacgacaagaggataaagctgcaaatctgggacacagcgggg
caggagcgttacagaaccatcaccaccgcttattaccgtggagccatgggattcatcctc
atgtacgacattaccaatgaggagtctttcgctgcagtgcaggactggtccacacagatt
aagacatactcatgggataacgctcaggtgcttctagtcggcaacaagtgtgacatggag
gatgagagggtcgtggcttctgaaaggggcagacagctctctgagcatcttggttttgaa
tatttcgaagccagtgccaaggacaacattaatgttaaacaaaccttcgagcggttggtg
gacataatctgcgagaagatgtcagagagcctggatgctgccgatcctgcagtgacggga
gccaaacaagggccgcagctcacagagcagcccgccgccccgcaccaggactgcgcctgc
tga

DBGET integrated database retrieval system