KEGG   Danio rerio (zebrafish): 550477Help
Entry
550477            CDS       T01004                                 

Gene name
arpin
Definition
(RefSeq) arpin
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0552 UPF0058 ASH RdgC Prot_ATP_OB_N
Motif
Other DBs
NCBI-GeneID: 550477
NCBI-ProteinID: NP_001017780
ZFIN: ZDB-GENE-050417-304
Ensembl: ENSDARG00000041085
Vega: OTTDARG00000013784
UniProt: Q1LWJ6
Position
18
AA seq 226 aa AA seqDB search
MSRIYDNTALLNKPVHNEKLSFTWDPIVHQSGHGVILEGTVVDFSRHAITDVKNRKERYN
VLYIKPSRVHRRKYDSKGNEIEPNFSDTKKVNTGFLMSSFKVEAKGETDCLDERQLREIV
NKEQLVKVTIKHCPREAFAFWISEAEMDKTELEPGQEVRLKTKGDGPFIFSSAKLDSGTV
TKCNFAGDENAGASWTEKIMANKSNQENTGKSAAQGEGADDDEWDD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtatttatgacaacactgcgttgttaaacaaacctgtgcacaacgagaaacta
tccttcacgtgggatccaatagttcaccagagtggtcatggggtgattttagaggggacg
gttgtggacttttcacgccatgccataacagatgtgaaaaacagaaaggagcgttataat
gttttgtacatcaaaccaagccgtgtccatcgtagaaaatatgattcaaaaggaaacgaa
attgaacctaatttcagtgataccaagaaggtcaacacaggttttctgatgtcctccttc
aaagtggaagctaaaggtgaaacagattgtctagatgagcgccagcttcgtgaaattgtg
aataaggagcagctggttaaagtaaccataaaacattgtcctcgtgaggcctttgctttc
tggatctcagaggcggagatggacaaaacagagcttgagcccggccaagaagtccgcctt
aaaacgaaaggagatgggccattcatattttcctccgccaaattggacagcggcacagta
acaaaatgcaacttcgctggagatgaaaacgccggggcatcgtggacagagaaaataatg
gcaaacaaatccaaccaggaaaatacagggaaaagtgccgctcagggtgagggagcggac
gatgatgaatgggatgactga

DBGET integrated database retrieval system