KEGG   Danio rerio (zebrafish): 552941
Entry
552941            CDS       T01004                                 

Gene name
maip1
Definition
(RefSeq) m-AAA protease-interacting protein 1, mitochondrial
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Tim44 MBA1
Other DBs
NCBI-GeneID: 552941
NCBI-ProteinID: NP_001032303
ZFIN: ZDB-GENE-050506-22
Ensembl: ENSDARG00000069671
Vega: OTTDARG00000026493
UniProt: Q32LQ2
Position
9
AA seq 243 aa
MALPLLRICNRPVSVLVRNFTSKSSLLNHSRRLAPAASVVCDVRRYSSEPERRKRNPRVV
VFGIPNPIIWFRNRIYFFLIRAYFDKEFSIEEFMEGAIQAFSHVSRLLSQCQFEALEGLV
AKDLIKKLEGKCAHLPLSHQRALSAEPDDIMYMTAGDVGIYYDDSERKFVSILMRFWYLT
SAKFPDESVDGAKVFQVAIGDEREKQTETKRLLTANYEFQREFTEGVTPDWIITRIEHSK
LID
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcgctgcccttactgaggatatgtaacaggcccgtttctgtcctggttcgcaacttt
acatcgaagtcatctttattgaatcactcgagacggctcgcaccagcggcgtctgttgtg
tgtgatgtccgtcgctacagctctgagccagagagacgcaagcggaacccaagggttgtg
gtgtttgggatacccaaccccattatctggttccgaaaccgcatctacttctttcttatt
cgagcttactttgacaaagagtttagcatcgaggagttcatggaaggagccatacaggct
ttctcgcacgtttcaagattgctctctcagtgtcagtttgaagctcttgaaggattagta
gctaaagatctaataaagaaactcgagggaaaatgcgctcatttgcctttgagccaccag
agggcgctgtccgcggagccggacgatatcatgtacatgacagcaggagacgtgggcatt
tactacgatgatagcgagaggaaatttgtgagtattttgatgcgcttttggtacttgact
agtgccaaatttcctgacgaaagtgtggatggagcgaaagttttccaggttgcaattggt
gatgagagagaaaagcaaaccgagaccaagagactgcttacagccaattatgagttccaa
agggagtttactgaaggtgtgactccagattggatcatcacaaggatagagcactcaaaa
cttattgactaa

DBGET integrated database retrieval system