KEGG   Danio rerio (zebrafish): 553135
Entry
553135            CDS       T01004                                 

Gene name
tas2r203
Definition
(RefSeq) taste receptor, type 2, member 203
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 553135
NCBI-ProteinID: NP_001018342
ZFIN: ZDB-GENE-050510-3
UniProt: Q58WW8
Position
9
AA seq 305 aa
MEPWLYALISSPLCLIGMVFNLLFFFCLMRPVSGVTLRNPLRFLLIVVLVNSTFQYLVIA
VTIIMLLFDYIFWLETVTRALIYQFFCGNFLCNAWISIFYYISIVPQHHAIFIWIKRNIK
AILYGGFILNQIVLTFAISTGAVTYFFLGPVPVNFTALELNSTALAQTLEADMFLFHVAN
FSYLLYCTCPLVTLIVSWGKTFFYLRGHMKKMGQSGESFSQPQQKSQMRVTVTGMVQAAL
FLPSSLWTVAAALLYITGLFEEVDPSRFITMTFCSLSSLGNLLCFGFSQSVFRRGIVSVI
KKLKG
NT seq 918 nt   +upstreamnt  +downstreamnt
atggagccatggctgtacgctttaatctccagtcccctctgcctcataggcatggttttc
aacctcctcttctttttctgcctcatgcggccagtctccggagtgacgcttcgtaatcca
ctgcgcttcttgttaattgttgtgctcgtcaattctacatttcaatatctggtcatagcc
gtgaccattattatgcttctttttgattacattttctggctggaaacagttaccagagct
ctgatttatcaattcttttgcggaaacttcttgtgcaatgcctggatcagcattttctac
tacatatcaattgttcctcaacatcatgccatcttcatctggattaagaggaatattaaa
gctattttatatgggggcttcattctaaatcaaatagtgcttacgtttgctatatctacg
ggggcagtgacatatttttttcttgggcccgtcccagttaattttactgcacttgaactg
aactcaacagcactagcacaaaccttagaggcagacatgtttttgtttcatgtggcaaat
ttttcatatttgctatattgcacctgcccgttggtcacactgatagtctcttggggcaaa
acttttttttatctgcgtggacatatgaaaaagatgggacagagcggcgagtctttttcc
cagccccagcagaagagccagatgcgagtcacagtgacaggtatggtgcaggcagcactg
ttcctacccagtagcctgtggacagtagcagctgctctcctctacattacaggcctcttt
gaagaggtggatcccagcaggtttatcacaatgactttctgctcactgtccagcttggga
aatctgctgtgtttcggattctcccagtctgtgtttcgccgtgggattgtaagtgtgatt
aaaaagctaaaaggttga

DBGET integrated database retrieval system