KEGG   Danio rerio (zebrafish): 553401Help
Entry
553401            CDS       T01004                                 

Gene name
hadhaa
Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00062  Fatty acid elongation
dre00071  Fatty acid degradation
dre00280  Valine, leucine and isoleucine degradation
dre00310  Lysine degradation
dre00380  Tryptophan metabolism
dre00410  beta-Alanine metabolism
dre00640  Propanoate metabolism
dre00650  Butanoate metabolism
dre01040  Biosynthesis of unsaturated fatty acids
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01212  Fatty acid metabolism
Module
dre_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dre_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
dre_M00085  Fatty acid biosynthesis, elongation, mitochondria
dre_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    553401 (hadhaa)
   00650 Butanoate metabolism
    553401 (hadhaa)
  Lipid metabolism
   00062 Fatty acid elongation
    553401 (hadhaa)
   00071 Fatty acid degradation
    553401 (hadhaa)
   01040 Biosynthesis of unsaturated fatty acids
    553401 (hadhaa)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    553401 (hadhaa)
   00310 Lysine degradation
    553401 (hadhaa)
   00380 Tryptophan metabolism
    553401 (hadhaa)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    553401 (hadhaa)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     553401 (hadhaa)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     553401 (hadhaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 553401
NCBI-ProteinID: NP_001098746
ZFIN: ZDB-GENE-031222-5
Ensembl: ENSDARG00000057128
Vega: OTTDARG00000028841
UniProt: A7YT47
Position
20
AA seq 761 aa AA seqDB search
MASARLLLARGCTGVKSSFTGHGQRSLSVSSAVLARTHVSYEVKDNVAVVRINDPTSKVN
TLSKHMQAEMVEVMNEVWGNSSVKSAVLISRKPGCFIAGADINMIQACTTAEEVTSLSQA
GQKMFEQIEKSPIPIVAAINGSCLGGGLEFAIACQYRIATKSKKTVLGTPEVMLGLLPGA
GGTQRLPKMVGLPAAFDMMLTGRNIRADKAKKMGLVHQLVDPLGPGLKSPEERTIEYLEE
VAVDFAKGLAAKKVTLEKKKGLMQKVQDFVMGLSLVRQQIYKTVHGKVMKQSKGLYPAPL
KIIECIQTGIEKGNAAGYLAEAQNFGQLAMSSESRALIGLYHGQVACKKNHFGKPEREVK
NLAILGAGLMGAGIAQVTIDKGVATILKDTTLEGLARGEQQVYKGLNDKTKKKSLTTFER
DGIMSKLSGQLDYHGFEKADMVIEAVFEDLAIKHKVLKEVEAVIPPHCIFATNTSALPIK
DIAAASKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAIGLKQGKLIVVVGDG
PGFYTTRCLAPMLAEAVRILQEGVGPKKLDSLTTGFGFPVGLATLADEVGIDVAAHVAED
LGKAFGARFGGGNVDFLKTMVQKGFKGRKSGKGCYVYGAKSKEKKVNSEAEEILKSFKLT
APPAVSSDEDIQYRLVSRFVNEAVLCLQEGILADPIQGDIGAVFGLGFPPCLGGPFRFVD
SYGADKLIQKMKRFEEVYGNQFSPCQLLLDHAKNTSKRFHK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgcaagactcttgttggctcgaggctgcactggcgtgaaatctagtttcaca
ggtcatggacagagatctctctccgtatcatcggctgtgctggcgcgcactcatgtcagt
tatgaggtcaaggataatgtggctgtggtgagaatcaatgatcccacctcgaaggtgaac
actctgtccaagcacatgcaggctgagatggtggaggtgatgaatgaagtttgggggaat
tcatcagtaaagagcgccgtcctcatctccagaaaaccaggatgcttcatcgcaggagcc
gatatcaatatgattcaggcctgtacgacagcagaggaagtgacctcactctcacaggcg
ggacagaagatgtttgagcagattgagaagtcaccaatccctattgtggctgccataaac
ggctcctgtctgggcggaggactggagtttgctattgcgtgtcagtaccgcattgccact
aagagtaagaagacagttctgggcaccccagaggtgatgctgggtctgctgcctggcgcc
ggaggcactcagaggctgcctaaaatggtcggtcttcctgctgcgtttgatatgatgctg
actggcagaaacatacgggcggataaagccaagaaaatggggctcgtccatcagctggtg
gatcctctgggtcccggattgaagagtccagaagaaaggacaatcgagtatctggaggaa
gtggctgttgattttgctaaaggtctcgctgctaaaaaagtcaccttggaaaagaagaaa
gggctcatgcagaaggtgcaggattttgtgatgggtctgtcactggtccggcaacagatc
tacaaaactgtccatggcaaagtcatgaaacagagtaaaggtctttatcctgcaccgctg
aagattatagagtgtattcagaccggcattgaaaaaggaaacgctgcaggatacctggct
gaagctcagaacttcggtcagctggcgatgtcatcagaatccagagctctgattggtctt
tatcatggtcaggtggcctgcaagaagaaccacttcgggaagccggagagagaagtgaaa
aatctggctatcctaggggcggggcttatgggagcgggaattgcccaggtgaccatagac
aagggtgtggccactattttaaaggacacgacactggaaggcctcgccagaggtgaacag
caggtgtacaaaggacttaatgacaaaaccaagaagaagagtctgacgacgttcgagaga
gatggcatcatgtcaaagctgtcaggacagctggattaccacggctttgagaaagcagac
atggtcatcgaagcagtgtttgaagacctggccataaaacacaaagtgctaaaggaggtt
gaggctgtgattcctcctcactgtatctttgccaccaacacatctgctctgcccattaaa
gacatcgcagctgccagtaagaggcctgagaaggtgatcgggatgcattatttctctcct
gtggataaaatgcagctgctggaaatcatcaccaccgacaaaacctccaaagacaccacc
gcgtctgccgtggccatcggactcaaacaggggaagctcatcgtagtagtgggggatggt
ccagggttttacaccactcgctgtctggcacccatgttagctgaagcggttcgaattctt
caggaaggagtcgggcccaagaaactggattccctgacaacaggattcgggtttcctgtg
ggcttagcgacacttgctgacgaggtcggtattgacgtggcggctcatgttgcagaggat
cttggcaaggcttttggagcgcggttcggaggaggaaatgttgacttcttgaagaccatg
gtgcaaaaagggttcaaaggacgcaagtctggaaagggttgttatgtgtacggagccaag
tcaaaagaaaagaaagtgaactcagaagctgaagaaattctcaagagcttcaagctaaca
gcgccccctgctgtctccagcgatgaggatattcagtacagactcgtgtctcgatttgtg
aacgaggccgtgctgtgtctacaggaaggcattctggccgaccccattcagggagatatt
ggagctgtgtttggacttggattcccgccttgcttgggaggtccgttccgttttgtggat
tcttacggcgcagacaaacttatccagaaaatgaagcgctttgaggaggtttatggtaac
cagttcagtccctgccagcttctccttgatcacgctaaaaacaccagcaagaggttccac
aagtga

DBGET integrated database retrieval system