KEGG   Danio rerio (zebrafish): 553553
Entry
553553            CDS       T01004                                 

Gene name
cfd
Definition
(RefSeq) complement factor D precursor
  KO
K01334  complement factor D [EC:3.4.21.46]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    553553 (cfd)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.46  complement factor D
     553553 (cfd)
Peptidases and inhibitors [BR:dre01002]
 Serine peptidases
  Family S1: chymotrypsin family
   553553 (cfd)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 553553
NCBI-ProteinID: NP_001018368
ZFIN: ZDB-GENE-050522-411
Ensembl: ENSDARG00000039579
Vega: OTTDARG00000027815
UniProt: Q6DBS8
Position
13
AA seq 249 aa
MNRLIFFSVLFYAAFHTGDCITGGQEAKAHSRPYMASVQWNGKHECGGFLISSQWVMSAA
HCFQDGRTSGVKVVLGAHSLSGAEDTKQTFDAEVYNHPDFSISNYDNDIALIKLDKPVTQ
SDAVKPVKFQRDETADPKEAAVVETAGWGSLNNMGGRPDKLHELSIPVMERWRCGRADFY
GEKFTSNMLCAADKRKDTCDGDSGGPLLYRGIVVGITSNGGKKCGSSRKPGLYTIISHYA
SWIDTTTTK
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaacaggctgattttcttctctgtgctgttctatgcagcatttcatactggtgactgt
atcacgggagggcaagaggctaaagcacactctcgcccgtacatggcttcagttcagtgg
aatggaaaacatgaatgtggtggctttctgatctccagtcagtgggtcatgagtgctgca
cattgctttcaggatgggaggacatctggtgttaaggttgttttgggtgctcactcgttg
tctggagccgaggacacaaagcaaacttttgatgctgaagtatacaaccatcctgatttc
agcattagcaactatgacaatgacattgccctgattaagttggataagccagtcactcag
agcgatgcagtcaaaccagtgaaattccagcgtgatgagacggctgaccctaaagaagct
gctgttgtagaaacggctggttggggctcattgaacaacatgggaggacgacctgacaaa
cttcatgagctcagtatcccagtaatggagcgatggcgctgtggccgtgctgacttctat
ggagagaagtttaccagcaacatgctctgtgctgcagacaaaagaaaggacacctgtgat
ggggactccggcggtcctcttttatacagaggcattgttgtcggaataacgtctaatgga
gggaagaaatgtggctcctccagaaagcctggactctacacaatcatttcccactacgct
agttggattgatactacaactactaagtaa

DBGET integrated database retrieval system