KEGG   Danio rerio (zebrafish): 553579
Entry
553579            CDS       T01004                                 

Gene name
fabp4b
Definition
(RefSeq) fatty acid binding protein 4b
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    553579 (fabp4b)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 553579
NCBI-ProteinID: NP_001018394
ZFIN: ZDB-GENE-050522-391
Ensembl: ENSDARG00000002311
Vega: OTTDARG00000022032
UniProt: Q503X5
Position
16
AA seq 134 aa
MVEQYVGKWKMTSSDNFDEYMKAVGASFASRQMANLAKPSLLIAVDEQGVITMKAVTTFK
TLEIKFKLDEEFDETTADDRKVKTTMSLADGKLIQKQTWEGKTTIIEREIQDTKMIAKCT
MDDVVAIRTYEKDA
NT seq 405 nt   +upstreamnt  +downstreamnt
atggttgagcagtacgttggaaaatggaaaatgacttcaagtgacaattttgatgaatac
atgaaggctgtaggtgctagttttgcctctcgacaaatggcaaatcttgctaaaccaagt
ttgttgattgctgtggatgagcagggcgtcatcactatgaaagctgtcactacattcaag
accctggaaatcaaattcaagttagacgaggaatttgatgagacgacagcagatgacaga
aaagtgaagactactatgagccttgcggatggtaaacttattcaaaagcagacctgggaa
ggaaagaccacaataatcgaaagagagattcaagacacgaaaatgatagcgaaatgcacc
atggatgacgttgtggctatcaggacatacgaaaaagatgcatga

DBGET integrated database retrieval system