KEGG   Danio rerio (zebrafish): 553683
Entry
553683            CDS       T01004                                 

Gene name
lpcat2
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 2
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00564  Glycerophospholipid metabolism
dre00565  Ether lipid metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    553683 (lpcat2)
   00565 Ether lipid metabolism
    553683 (lpcat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dre01004]
    553683 (lpcat2)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     553683 (lpcat2)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     553683 (lpcat2)
Lipid biosynthesis proteins [BR:dre01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   553683 (lpcat2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 Acyltransferase EF-hand_4 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 553683
NCBI-ProteinID: NP_001018492
ZFIN: ZDB-GENE-050522-229
Ensembl: ENSDARG00000053010
Vega: OTTDARG00000022130
UniProt: Q502J0
Position
7
AA seq 529 aa
MPPPHRVFALPRQQSLLLPAVINPFVHDLSLSTADITKCFLLGIILVPLRAIFLLLVLLV
MWPVSVIITFGQSLKGVVEPMTGWRRFLHRRVMTFLGRMYFFGMGFKVVVKGKKASTLEA
PILAVAPHSSFFDAIACIESGLPSTVSRIESLEAPIFGRFLRCVQPVLVSRTDPDSRRNT
IIEIERRAKSGGHWPQVLIFPEGTCTNRSCLITFKQGGFVPGVPVQPVLIRYPNKLDTVT
WTWQGPKSARLLLLTLCQLCTTVEVEFLPPQVPTEMEKKCPLKFAQSVRAVMAKSLKLPV
TDHTYEDCRLMIAAGELTLPMEAGLVEFTKISRKLELKWDNVKKELESFANIACSCKGGR
ITVEEFASFLKLPISPALQQLFALFDRNGDGTIDFREYVIGVTVLCRPANNEEVIQTAFK
LFDIDEDNCITQEEFSSLLRSALGVCDLDVHSLFREIDADGSGHITYDEFRSFALNHPEY
AKLFTTYIELQRYQGLQGDETDFDSAFSHCCTAAYDEYQEDSASDKKDD
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgcctccgccgcacagagtattcgcgctgcccagacaacagtccctgctgctgcccgcg
gtcatcaacccgttcgtgcacgacctgagcttaagcacagccgacataaccaaatgtttt
cttctaggaattatccttgtgccgctccgtgccattttcttgcttctagttctcttggtc
atgtggcctgtttctgtcataataacattcggacagtctctgaaaggagtggtggagccc
atgaccggctggagaaggtttctgcacagaagagtgatgacctttcttggccgaatgtat
ttctttgggatgggcttcaaggtagtggtgaaggggaagaaggccagcactttagaggcc
cccattctagctgtggccccccactcttcgttctttgatgccatcgcctgtattgaatct
ggtctgccttctaccgtatcccgcatagagtctctagaagcaccaatcttcggcaggttt
ttgcgttgtgtgcaacctgtgctggtatcacgcactgatccagactctcgtagaaacact
atcattgagattgaaaggagagccaagtcaggaggacactggccacaggtgctcatcttt
cctgaaggaacatgtacaaacagatcatgtcttattaccttcaagcaaggtggctttgtc
cctggggtcccagtgcagcctgttcttatcagatacccaaataagctggatacagtcaca
tggacatggcaaggcccaaaatcggccagactactgctgctcacactctgccagctctgt
actacagtggaggtcgagtttttgccccctcaagtacctacagaaatggagaagaagtgt
cctttgaagtttgctcagtcggtgagagctgtcatggctaaatctctgaagctgccagtc
acagaccacacttatgaagactgccgtttgatgattgctgctggagaactgactctgcct
atggaagctggactagtggagtttaccaagatcagcagaaaattggaattaaaatgggac
aatgtgaagaaggagttggagagttttgccaacatagcttgttcttgcaaaggcgggagg
atcaccgttgaggaattcgccagcttcctcaaattacccatcagcccagctctacagcag
ctcttcgctctgtttgacaggaatggggatggcactattgatttcagagagtatgtcatt
ggtgtcacggttctgtgccgaccagctaataatgaggaagttattcagactgcttttaag
ttgtttgacatcgatgaggacaactgtatcacacaagaggagttcagtagtttgctacgt
tcagctcttggagtgtgtgatctcgacgtccacagcctcttcagagaaattgatgcagat
ggatcaggacacataacttatgatgagtttcgttccttcgctctcaatcatcccgaatat
gcaaagctcttcaccacctacatcgagctccagcgttaccagggtctgcagggggacgag
actgacttcgacagtgctttttctcactgctgtactgctgcttatgatgagtatcaggag
gacagtgcctctgacaagaaagatgactga

DBGET integrated database retrieval system