KEGG   Danio rerio (zebrafish): 553785
Entry
553785            CDS       T01004                                 

Symbol
lrrc4ca
Name
(RefSeq) leucine rich repeat containing 4C, genome duplicate a precursor
  KO
K07523  netrin-G1 ligand
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    553785 (lrrc4ca)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig V-set LRR_9 Ig_2 LRRNT Mid2 Ig_6 DUF4293 Syndecan Insulin_TMD
Other DBs
NCBI-GeneID: 553785
NCBI-ProteinID: NP_001018583
ZFIN: ZDB-GENE-050522-533
Ensembl: ENSDARG00000113411
UniProt: Q503I7
Position
25:complement(9675873..9805269)
AA seq 647 aa
MINKMTSSLMQQTMRGPRWNRALSDPLFVLSLALQLLVVAGLVRAQTCPSVCSCSNQFSK
VICTRRGLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLSKNHIRNIEIGA
FNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRVPSLRRLDL
GELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSIIRPGSF
KGLVHLQKLWMMHAQIQTIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHHLERVHLH
HNPWNCNCDILWLSWWLKEMVPANTSCCARCSSPTSHKGRYIGELDQNYFHCYAPVIVEP
PADLNVTEGMAAELKCRANSLTSVSWITPNGSIMTHGAYKIRISVLNDGTLNFTNVTMQD
TGTYTCMVSNSAGNTTASATLNVSSTENSSFSYFTTVTVETTEAPPDEGHPTVQQKNGPT
PSSGIWETLPPSFTTTTTTARTPLSTKATDKTYTIPVTAQSDGSLNTLDEVMKTTKIIIG
CFVAITLMAAVMLIIFYKMRKQHHQQNHHAPTRAIEIINVDEDCMTGGPAMESHLALPPL
DHEHLNHYNAYKTAYNHASTINSIHSSAHEPLLIRASSKDNVQETQI
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgataaacaagatgacctcctccctgatgcagcagacgatgagaggtcctaggtggaac
cgggcactgtccgacccattgtttgtgctgtcgctggccctgcagcttttggtggtggct
ggtctggtgcgagcacagacctgcccctccgtctgctcctgtagcaaccagttcagcaag
gtcatctgtacgcgccgtggccttcgagatgtacctgatggtatttccaccaacacaaga
tacttgaaccttcaggagaacctcatccaggtgattaaggtggacagctttaaacatctt
agacacctggagattctgcagctcagcaaaaaccacattcgtaacattgaaatcggagcc
ttcaatgggctggccaatctcaacacactagagctctttgataatcgacttaccacaatt
cccaatggggctttcgagtacctgtctaaacttaaggagctttggttgaggaataaccct
atcgagagtataccctcttatgccttcaaccgtgtaccatcgttgagaaggttggacttg
ggtgaactgaaaaggctgtcatatatctcagaaggtgcctttgagggcctcagcaacctg
cggtacctgaaccttggtatgtgcaacttgaaggagatccccaacctcattcctcttgtt
cgtttagatgagttggagatgtcaggaaaccagctctctataattaggccaggatctttc
aaaggccttgtccatttacagaaactgtggatgatgcatgcacagatccagacgattgag
agaaatgccttcgatgatctccagtcccttgtggagctcaatttagcccacaataacctt
acactcttgccccatgacctcttcaccccacttcaccacttggagagggtgcacttgcac
cacaacccttggaactgcaactgtgacatcctctggctcagttggtggctaaaggaaatg
gtaccggccaataccagttgctgtgcccgctgttcatcacctaccagccacaaaggtcgc
tacattggtgaactcgaccagaattatttccattgttatgcaccagtgatcgtggagcct
cctgcggatctgaacgtaaccgagggcatggcggcagaactgaaatgtcgagcaaattct
ttgacctcggtgagctggattacacctaatgggtctattatgacacacggggcgtacaag
atacgcatttctgtgctcaatgatgggacgttaaactttaccaatgtcacaatgcaggac
acaggaacatacacttgtatggtgagcaactccgcaggcaacactacagcctctgctaca
cttaatgtgtcctcaacagagaacagcagcttcagttacttcaccacagttaccgtcgag
accacagaagctccacctgatgagggccacccaacagtacagcaaaagaatgggcccact
ccctcttctggaatttgggagaccttgccaccttccttcaccaccaccacgaccacagca
cggacgccactgtctacaaaggctaccgacaagacctacaccatccctgtcacagctcag
agcgacggctccctcaacaccttggatgaggtcatgaagaccacaaagatcatcatcggt
tgctttgtggctatcacactcatggcagctgtcatgctgattatattttataaaatgcgc
aaacagcatcaccagcagaaccaccacgcgccaacgcgagccatcgagatcatcaatgtg
gatgaggactgcatgacgggtggacctgccatggagagccacctagccctgcccccactt
gatcatgagcacctgaatcattacaacgcctacaaaactgcatacaaccatgcctccacc
atcaattctatacacagctctgcccacgaacctttactaattcgggccagctcaaaagac
aatgtacaagaaacccagatctga

DBGET integrated database retrieval system