KEGG   Danio rerio (zebrafish): 554089
Entry
554089            CDS       T01004                                 

Gene name
s100z
Definition
(RefSeq) protein S100-Z
  KO
K23772  protein S100-Z
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    554089 (s100z)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  S100 proteins
   554089 (s100z)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 CRISPR_Cas9_WED
Other DBs
NCBI-GeneID: 554089
NCBI-ProteinID: NP_001019562
ZFIN: ZDB-GENE-050522-69
Ensembl: ENSDARG00000038729
UniProt: Q503K9
Structure
PDB: 
2Y5I

Position
21
AA seq 99 aa
MPSKLEGAMDALITVFHNYSGSEGDKYKLSKGELKELLNAELTDFLMSQKDPMLVEKIMN
DLDSNKDNEVDFNEFVVLVAALTVACNDFFQEQQKKRSK
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcccagtaaactggagggagcaatggatgcgctgatcaccgtcttccacaactactcc
ggcagtgaaggagacaaatacaaactgagcaaaggagagctgaaggagcttctcaacgct
gaactcaccgacttcctcatgtctcagaaggacccgatgctggtggagaagatcatgaac
gatctggactccaacaaggacaacgaggtggactttaatgagtttgtggttctggtggcg
gcgctgactgtggcctgtaacgacttcttccaggaacaacagaagaaaaggagcaaatag

DBGET integrated database retrieval system