KEGG   Danio rerio (zebrafish): 554230Help
Entry
554230            CDS       T01004                                 

Gene name
kdr
Definition
(RefSeq) vascular endothelial growth factor receptor 2 precursor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    554230 (kdr)
   04370 VEGF signaling pathway
    554230 (kdr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    554230 (kdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    554230 (kdr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dre04090]
    554230 (kdr)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     554230 (kdr)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   554230 (kdr)
CD molecules [BR:dre04090]
 Proteins
  554230 (kdr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set Izumo-Ig Ig_6 TMEM154 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 554230
NCBI-ProteinID: NP_001019824
ZFIN: ZDB-GENE-041001-112
Ensembl: ENSDARG00000017321
Vega: OTTDARG00000004983
UniProt: Q5GIT4
Position
20
AA seq 1357 aa AA seqDB search
MAKTSYALLLLDILLTFNVAKAIELRFVPDPPTLNITEKTIKINASDTLQITCRGRQILE
WSTPHNRTSSETRLTISDCSGDGLFCSTLTLSKAVANETGEYRCFYKSPPKEDGKTSVAV
YVFIQDYRTPFVRIAQDYDVVFIREGEQVVIPCLVSVEDLNVTLYTKYPVKELSTDGKEV
IWDSRRGFILPSRVVSYAGVVYCQTTIRNETFQSSPYIVAVVGYKIYDLTLSPQHERLTV
GERLILNCTAHTERNVGIDFQWTFPHEKRSVNGSMSTSRYKTSSNKKKLWNSLELSNTLT
VENVTLNDTGEYICTASSGQMQKIAQASLIVYEKPFIALSDQLWQTVEAKAGDAEAKILV
KYYAYPEPAVRWYKNDQLIVLRDGYRMKFYRGVHLTIYGVTEKDAGNYTVVMTNKITKEE
QRRTFQLVVNDLPRIFEKDVSLDRDVHMYGSSPTLTCTGSGGSSPVTIKWQWMPREDCPV
RFLPKSDPSMAKCDKWREMSNNTGKNPLISQTSVDERTLKTISTLKIQKAVDHALYRCIA
TNKMGQDQRVIVFQVTRFLNLSVLPSSSPIEGQDVIMRCVADRLLYYNLRWYRVANVANH
DPPPAAVPCDTLTLSHLHQPNVTVSGLQGTNVTLDMPIPNATMMDQGLYACQVEIVGTNE
KTCLLHNLRLRALEMSRIVTNLTDQRVNVSDSTTLVCEVSGTPTPTIVWTKDNQTVMEGS
GVILKRSNRVLTIQRVKKEDSGLYICTACNQQGCESSEARISVDGAEEKMNVELIMPIGA
VVIAMFLWLLIVFVIRNRKRPNDGDLKTGYLSIILDSDDMPMDEHCERLTYDASKWEFPR
DRLKLGEPLGRGAFGQVVEATAYGIEKATTCTTVAVKMLKEGATSSEYRALMSELKILIH
IGHHLNVVNLLGACTKQGGPLMVIVEYCKHGNLSSYLKSKRGEYSPYKKRTPRMPNRREV
QQDEDPREGDLGLGTSTRLDICTGTAVCTRTGEQTSTTLQDEQESSDWDHLTMEDLISYS
FQVAKGMEFLASRKCIHRDLAARNILLSENSVVKICDFGLARDVYKDPDYVRKGDARLPL
KWMAPETIFDRVYTTQSDVWSFGVLLWEIFSLGASPYPGVCIDESFCRRLKEGTRMRAPD
YATPEIYQTMLDCWLDRPLDRPTFTQLVEHLGNLLQASAQQDGKDYIPLTNGEMEEELVA
PHLNVTSKRSFYAGNTEAQLHYGNAPPLGFPQQINSSGVPVNMTGFVDIPLEHTTVMDGH
VDCGVGLSREQMKALDRQAQRPLNFSPLLRCKSKESLASESSNQTSGYQSGYHSDDAEAP
IYANEEMILKRDIRKKPPLPKRNDKFSAEVRYSAPPV
NT seq 4074 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacatcttatgcgcttttactcctcgacatcctcctcaccttcaacgtggct
aaagcgatagagctcaggtttgtacctgatcctccaaccttgaacatcactgagaagact
atcaaaatcaatgcttcagatacacttcaaatcacatgcaggggtcgtcaaattctggag
tggtccacacctcacaaccggaccagctctgaaacccggctcactatatccgactgtagt
ggcgatggactattctgcagcactctgacactttccaaagctgtagccaatgagacaggc
gaataccgctgcttctataagagcccgccaaaagaggatgggaaaacatctgtagctgta
tatgtcttcatacaagattaccgtacaccatttgtccgaattgctcaagattatgatgtg
gtattcattcgagagggggaacaggtggtcattccctgtctggtgtctgtggaggacctg
aatgttacactttacacaaagtatccagtaaaagaactgtccactgatgggaaagaggtg
atctgggatagcaggaggggcttcatcttgcccagtcgtgtggtcagctatgctggagtc
gtctactgccaaaccactattcgaaacgagacctttcagtcctcaccttacattgtggct
gttgtaggatacaagatctatgacctcaccctgagtccacagcatgagaggctgacggtc
ggagagagactcatactcaactgcaccgcgcacacagagcgcaatgtgggaatcgacttc
cagtggaccttccctcatgagaagagaagtgtcaacggctcaatgtcgacctcacgctac
aagaccagctccaacaagaaaaagctgtggaactcattggagctgtccaataccctcact
gtggagaatgtgactttaaatgacactggagagtatatttgtactgcttctagtggtcag
atgcagaagattgcccaagcatccctcatagtctatgaaaagccatttatagcactcagt
gatcaattgtggcagactgtggaggcaaaggctggcgatgcagaggcaaaaatccttgtt
aaatattacgcttatccagagcccgctgtcagatggtataagaatgatcagctgatcgtc
ttgagggacgggtacaggatgaagttctacagaggagtccatctcactatatatggagta
acagagaaagatgctgggaattacactgttgtcatgacaaataagattaccaaagaggag
cagagaagaacatttcagctcgtggttaatgatctacccaggatctttgagaaggacgtg
tcgttggatcgtgatgtccacatgtacggcagtagccctacactgacctgcaccggtagt
ggaggatccagccctgtcacaatcaaatggcaatggatgcccagagaagactgtccagtc
agatttctaccaaaatcagacccgagcatggcaaagtgtgacaaatggagggagatgtca
aacaacacaggaaagaatcccctcatcagccagacgtctgttgatgaacgcactctcaag
accatcagcactctgaagatccagaaagcagtggatcatgccctatacaggtgcatcgct
accaataagatgggtcaagatcagcgagtcattgtgtttcaagtaactcgttttctcaac
ctaagcgtcctcccctccagcagccctattgaaggacaggatgttataatgcgttgtgta
gcagaccggctgctgtactataacttgcgctggtatcgggtagcaaatgtagccaaccat
gatccacctccagcagctgtgccgtgtgatactctcacactgtcacacttacaccagccc
aacgtcactgtttcaggcctgcaggggaccaatgtcacactggacatgcccatacccaat
gccacaatgatggaccaaggcttgtacgcttgccaggtggagattgtgggcaccaatgag
aaaacctgcttacttcacaatctcagactcagagctcttgagatgtccagaattgtgact
aatctgacggaccagagagtgaacgtgagcgactccaccactctagtgtgtgaagtgtcc
ggcacaccgacccctactatagtctggactaaagacaaccagactgttatggagggttca
ggtgtaattctgaaacgctcaaatcgtgtcttgaccatccagagggtgaaaaaagaggac
agtggtctgtacatttgtacagcatgcaaccagcagggctgtgaatccagtgaggctcgt
atctctgtggacggtgcagaagaaaagatgaatgttgagctgatcatgcctattggtgcc
gtggtcattgccatgttcctctggctcctcatcgtcttcgtcatccgcaacaggaagcgg
cctaatgatggagatctgaaaactggctacctgtcaattattctggactcagatgatatg
ccaatggacgagcactgcgagagactgacctatgatgcaagcaagtgggaattcccacga
gatagactgaagctgggagagccactgggcagaggggcatttggtcaagttgtggaggcg
actgcatatggcatcgagaaggccaccacctgcaccacagtagcagtgaagatgctcaag
gagggtgctacctccagtgagtaccgcgctttgatgtctgagctgaagatcctcatccat
ataggtcaccatctcaatgtggtcaaccttctaggggcctgcaccaaacaaggaggaccc
ttgatggtgattgtagagtactgtaaacatgggaacctctccagctatttgaaaagcaaa
agaggagagtacagtccctacaagaaacggacgccacgaatgccaaacaggagggaggtt
cagcaggatgaggatccacgtgagggggatctgggtctgggaaccagcactagactggat
atctgcaccgggacagctgtgtgcaccagaacgggggaacagacctccacaactctgcag
gatgagcaggagagttcagactgggatcatctgacaatggaggacctgatcagctatagc
ttccaggtggccaaaggcatggagtttcttgcctctcgaaagtgtatccatcgtgacttg
gcagccagaaatatcctactctctgaaaacagtgtggtgaaaatctgtgactttgggctt
gccagagacgtgtataaagaccctgattacgtccgtaaaggagatgctcgtcttcctctc
aaatggatggctcctgagaccatctttgaccgcgtgtacacaacacagagtgacgtctgg
tctttcggcgtgctgctctgggagatcttctcacttggtgcatctccatatccgggtgtg
tgcattgatgagtctttctgcaggcgacttaaagagggaaccagaatgagagctccagat
tacgccacgcctgaaatataccagaccatgctggactgctggcttgatcgacctttagac
aggccaacttttactcagttagttgagcatctgggtaatctgctacaagctagtgctcaa
caggatggaaaagactacatcccgctgacaaacggagagatggaggaggaactggtggct
cctcatctaaatgtgacgtctaaaagatctttctacgccggcaacacagaggcacagctc
cactatggtaacgctccgcctctcgggtttcctcagcagataaacagcagcggtgtgcca
gtgaatatgacaggttttgtggacattcccctggagcataccactgtaatggatggccac
gtggactgtggagtgggtttatcacgtgaacagatgaaagctttggatcgtcaggcacaa
aggccactcaatttcagcccattactgcgctgcaagagtaaagagtccttagcttctgaa
tcgtccaatcagaccagcggctatcagtctggctaccattctgacgatgcagaagccccg
atatacgccaacgaggagatgatcctgaagagagacattcgtaagaaaccacctctgcct
aagagaaacgacaagttcagtgcagaggtccgttatagtgcacctccagtttaa

DBGET integrated database retrieval system