KEGG   Danio rerio (zebrafish): 554700
Entry
554700            CDS       T01004                                 

Gene name
pde6gb
Definition
(RefSeq) phosphodiesterase 6G, cGMP-specific, rod, gamma, paralog b
  KO
K13759  retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    554700 (pde6gb)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    554700 (pde6gb)
SSDB
Motif
Pfam: PDE6_gamma
Other DBs
NCBI-GeneID: 554700
NCBI-ProteinID: NP_001230011
ZFIN: ZDB-GENE-030904-1
Ensembl: ENSDARG00000101984
Vega: OTTDARG00000020640
UniProt: Q7ZVI5
Position
12
AA seq 87 aa
MNLEPPKPEIKSATRVTGGPATPRKGPPKFKQRQTRQFKSKPPKKGIQGFGDDIPGMEGL
GTDITVICPWEAFNHLELHELAQYGII
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaatcttgagccgcccaaaccagagatcaaatcggccacccgagtcaccggtggtccc
gcaacaccacgcaaagggccccctaaattcaagcagaggcaaacccgccagttcaagagc
aagcccccaaagaagggtatccaagggttcggagatgacatccccggcatggaaggttta
ggcactgacatcaccgtcatctgcccctgggaggccttcaaccatctggagcttcacgaa
ttggctcagtatggcatcatctga

DBGET integrated database retrieval system