KEGG   Danio rerio (zebrafish): 555344Help
Entry
555344            CDS       T01004                                 

Gene name
si:dkey-202e17.1
Definition
(RefSeq) uncharacterized protein LOC555344
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    555344 (si:dkey-202e17.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     555344 (si:dkey-202e17.1)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   555344 (si:dkey-202e17.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 555344
NCBI-ProteinID: NP_001121803
ZFIN: ZDB-GENE-060503-810
Ensembl: ENSDARG00000062278
Vega: OTTDARG00000014704
UniProt: A3KQK4
Position
19
AA seq 247 aa AA seqDB search
MTQPQNLQSRTQHVHATWGKRCDTILYMTSKNTDFPTIGLNVSEGRNQLYWKTIRAFQYI
HKHHLDDADWFLKADDDTFVVIENLRHSLSKHSSEDPLYFGRRFRPFVAQGYMSGGAGYV
LSKEALRRFVKGFADGLCTHTTELEDVGMGQCMEKMKVEMGDSRDVFGRQVFHPYPPGNY
LVRQLRRQRPWYLIYDHYTPVEGPGCCSDFAISFHYINAVEMHTLEYYTYHLRPYGYKYR
FNPDELK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcctcaaaacctgcagtccagaacccaacacgttcatgccacatggggcaaa
cgctgcgacaccatcttgtacatgacctcgaagaacacggacttccccacgatagggctc
aatgtgtcagaaggacgcaatcaactctactggaagaccatacgagccttccagtacatt
cacaagcaccatttggatgatgctgattggttcctcaaagctgacgatgacacatttgtt
gtcattgagaatttgcgccatagcttgtccaaacacagctcagaggatcctctgtatttt
ggacgtcgcttcaggccctttgttgcacaaggctacatgagtggaggggccggttacgtc
ctcagtaaagaagctttgagaagatttgtgaaggggtttgctgatggactttgtacgcac
accacagaacttgaggatgttggaatgggacaatgcatggagaaaatgaaagttgagatg
ggggattccagggatgtgtttgggagacaagtctttcacccttaccctccaggcaattac
ttggtgagacagctacgcagacaacgaccctggtacctcatctatgatcattatactcca
gttgagggtccgggatgctgctcagattttgccatctcattccattacataaacgcagtg
gaaatgcacacattggagtactacacatatcatttacgcccgtatggatacaaatacaga
ttcaatccagatgaactgaaatga

DBGET integrated database retrieval system