KEGG   Danio rerio (zebrafish): 555648
Entry
555648            CDS       T01004                                 

Gene name
bckdhbl
Definition
(RefSeq) sialic acid-binding Ig-like lectin 6 isoform X1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C2-set_2
Other DBs
NCBI-GeneID: 555648
NCBI-ProteinID: XP_005163898
ZFIN: ZDB-GENE-060830-1
Ensembl: ENSDARG00000093569
Vega: OTTDARG00000032389
UniProt: E9QF22
Position
3
AA seq 350 aa
MKFPAVQREKWLVLLTFLHMWIGSSNGCLYPGGDYEFKLKLDKNVIPALAGCAQIPCAYS
APMRTHSGRLVWFSGSPDFPISPRDMERKDGLLRPLASILEECSIVLWDFSGHERVEEYG
VMLEWGTNETHVYDERVAVSYSAAKLNISLHSEVLEAGKRTIIICSLPDLCLNSDPIVTW
KGLNSKQLRRLRFPREMETYLMYSEQLFYTPVPEDHQAEITCEATFGKNLSASATMTLTV
HSHPQILNSSTCSLKQDLLTCVCVSQGVPLPDVHWPLQNNIDFNTVVSSDGHITVRSTFT
MKVVDLTSISSPVCVSRNPLGQTNMTLPLNMDEVLEEPEGDGQSKNDLES
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaagtttccggcagttcagcgcgagaaatggctcgttttgctcacttttctgcacatg
tggattggatcaagtaatggatgcctttatccaggcggtgattatgagtttaaattgaaa
ctggacaagaatgtcatccctgctttggcgggatgtgcacagatcccctgtgcgtattct
gctccaatgagaacacattcaggccggctggtctggttcagtgggagccccgacttcccc
atcagcccacgagatatggagcgtaaggacggcctgctgagaccactggcttctattcta
gaagaatgcagcatcgttctgtgggacttcagcggacatgaaagagtcgaagaatatgga
gtcatgttagaatggggaaccaatgaaacacatgtttacgatgagagagtcgcggtgtct
tattctgctgcaaaactgaacatcagtctacactctgaagtccttgaagctggaaaacgc
acaataataatctgcagtcttccagacctctgcctcaacagtgatccaatagtaacctgg
aaggggctgaactcaaagcagctccgtcgtctgagatttcccagggaaatggaaacatat
ttgatgtacagcgaacagctcttctatacacccgtccccgaggatcaccaagccgagatc
acatgtgaagctacgttcgggaaaaatctgagcgccagtgctaccatgactttgaccgtt
cactctcatcctcagatactgaacagctccacgtgctctctgaagcaggatctgctcacc
tgtgtgtgtgtcagtcagggtgtgcctttgcctgatgttcactggcctctgcagaacaac
attgattttaacaccgttgtatcatcagacggccacatcactgtgagaagcaccttcacc
atgaaagtggtggacctcaccagcatcagttctccagtgtgcgtcagcagaaatccactt
ggtcagacaaatatgacgctacctctgaacatggatgaagtattagaggaaccagaaggt
gacgggcaatctaaaaatgatttggagagctga

DBGET integrated database retrieval system