KEGG   Danio rerio (zebrafish): 555950
Entry
555950            CDS       T01004                                 

Gene name
mov10b.2
Definition
(RefSeq) putative helicase mov-10-B.2
  KO
K18422  helicase MOV-10 [EC:3.6.4.13]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    555950 (mov10b.2)
   03036 Chromosome and associated proteins [BR:dre03036]
    555950 (mov10b.2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     555950 (mov10b.2)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     555950 (mov10b.2)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     555950 (mov10b.2)
SSDB
Motif
Pfam: AAA_12 AAA_11 AAA_30 AAA_19 MYCBPAP ResIII AAA_22 UvrD-helicase AAA_16 AAA_7 AAA ATPase_2
Other DBs
NCBI-GeneID: 555950
NCBI-ProteinID: NP_001037805
ZFIN: ZDB-GENE-060526-371
Ensembl: ENSDARG00000056065
Vega: OTTDARG00000018370
UniProt: Q1LXK5
Position
8
AA seq 1015 aa
MSRRNRNNYLSIAAVRTIGLDFIEMLEETNRRSISDRNTLTDIYNTEFRDRDGGVKDPNF
SRVLYALRNANKARLSRTGRVYFNTNVRTGLHDQWFRPRRRQQNQANATPGNVSSVTPSS
DQGPSCPESGVRARRKLVKYILQRLNTTDRSHFIADKWGVRVSSELYIEDGKIRISVDEA
EVYELKLFVENTGQEAVYFTYYTALCWLQYFTLEDSRKVTRNNPLRLEPREKYEVIVRFK
SSHVGVYSATLAFEFKKNTQPTTRSFHIVRFIEAEYRSKLAALLGPTEPYKPLRLNISEP
ENCIIDEGFPPDGYLQNFLVNVLPLGKYIPPPDTTILAELLKEDCSSRIFRGKLKDLQSL
LQSPLTFDNYAERFDLLLYLEECQMHVDIKRYNKDSVTLHRDRDKRLMGLNLPGVSENRP
SVLRGDHLLLTKSEEVTFSNVTKYKGYVHRVELDQVKLGLSKRFLKDVYIDKMKFRVEFT
VNRIPVRLQHRAVHMAVQHNLKDVLFPMASRSLNPVSPPALRLFDRKLEYNFQQYSAVCN
IVAGTSKPAPYLVFGPPGTGKTVTIVEAIKQVEKNIPDAYILACAPSNSAADQLCEKLIT
SEHVDAHKIYRLYASSRNQKDIPKILKDNCNVDEEMIDFPCKEDLMSYKILICTLVTAGR
LVTGGFSEDHFTHNFVDEAGHAVESETIISVAGLLNAEKGQLVLAGDPKQLGPILRSPLA
INHGLDVSLLERLMTQNDLYKRGDVEFDNRYVSKLIMNYRSHPYILEVPNRLFYDGELKA
CADEISSNQYCMWEHLPSKGFPVIFHGVPGKDERESNSPSFFNIYEINILVDYLKKLLLT
QPKKGISRIFPKDIGIIAPYRKQVEKIKRAIDADKDFQDYMGIDNLKVGSVEEFQGQERK
VIMVSTVRSSVKYISLDETFNIGFLKNEKRFNVAVTRAKSLLIMVGNPMILRTDESWGRF
IDFCLERGGYTGISITSVERIDDVESRLLALNIQDEETEESPVQRYVDPEFRNDY
NT seq 3048 nt   +upstreamnt  +downstreamnt
atgagcagaagaaacaggaataattacctttctatagccgctgtgcggacaattggattg
gattttatagagatgctggaggaaacaaacaggagatccatttcggacagaaatactctg
acagatatctacaacacagagtttcgagatagggacggtggagttaaagatccaaacttc
tctcgagtcctctatgcgttgagaaacgccaataaagcgcgcctctcaagaacaggtcgt
gtttacttcaatactaatgtaagaacggggctgcacgatcaatggtttcggccacgtcga
agacaacagaaccaagctaacgcaactccaggtaatgttagctcagtgacgccttctagt
gatcaggggccctcttgcccagagagtggagtcagagcaaggagaaaactggtaaaatac
atcctacagcgactcaacactacagacaggtctcattttatagctgataagtggggtgtg
cgggtgtcctctgagctctatatagaagatggaaagattcggatcagtgtggatgaagca
gaagtttatgagttgaagctgtttgttgagaacactggtcaggaagctgtatatttcaca
tactacactgctctttgctggctgcagtattttactctggaagacagtcggaaagtcaca
cgcaacaatccactccgtctggagccacgtgagaagtatgaggtgattgtgagattcaaa
tccagtcatgttggagtttattcggctactctggcatttgagtttaagaagaacacccag
cccaccacacgttccttccacattgtgcgcttcattgaggctgaatacaggagtaaactt
gcagccctgctgggtcctacagagccatacaagcccctgagactcaacatctctgaaccc
gaaaactgcataatagatgagggttttccacctgatggttatcttcagaactttcttgta
aatgttctgcccttggggaaatacattcctcctcctgacaccactatactggccgaactc
ctgaaagaggactgttcttctcggatcttcagggggaaacttaaggatcttcagtcactt
ttgcagagtccgctgaccttcgacaattatgcagaacgctttgatttactgctgtatctg
gaagagtgtcagatgcacgtggatatcaagagatacaataaagacagtgtcaccttacat
agggaccgtgacaaaagactgatgggtttaaatctccctggtgtctcagagaacaggcct
tcagtcctgagaggagatcacctgcttcttactaaaagcgaggaggtcactttttcaaat
gtgaccaaatacaagggctacgtccacagagtggaactggatcaggtcaaactgggcctc
tccaaaaggttccttaaagatgtatacattgataagatgaaattccgtgtcgagttcaca
gtcaatcgtattccggtaagattacaacacagagcggttcatatggcggtccagcacaac
ctcaaggatgtgctgttccctatggcctcaagaagtctgaatcctgtgtctccacctgct
ctgaggctctttgatcgaaagcttgagtacaactttcaacagtacagtgcagtgtgtaac
attgtggccggtacttccaaacctgcaccgtatctggtgtttggacctcctggcactggt
aaaaccgtcacgatagtggaggctatcaaacaggtggaaaagaatatcccagatgcctat
attctagcttgtgctccatctaacagcgccgctgatcaactgtgtgaaaagttgatcact
agtgaacatgttgatgcgcacaaaatatacagactctacgcaagctcacgaaatcaaaaa
gacattcctaaaatcctaaaggacaactgcaatgtggatgaagagatgattgatttccca
tgtaaagaggatctaatgtcctacaagatcctcatctgcactctggtcactgcaggcagg
ctggtcactgggggattttctgaggatcattttactcacaactttgtggatgaagctgga
catgctgtggagtcagagaccatcatcagtgtggcaggattgttgaatgcagagaaggga
cagcttgttttggctggggatcctaaacagctggggccaatcctgagatccccacttgcc
attaatcatggacttgatgtctctttgttagagaggctgatgacacagaatgatctttat
aagagaggtgacgtggaattcgacaaccgctacgtcagcaaacttattatgaattacagg
tctcacccatacattttggaggttcctaataggttgttctatgatggggaactgaaagca
tgtgccgatgagatcagctctaatcaatactgcatgtgggagcacttgccttcaaaggga
ttccctgtgattttccatggagttcctggaaaggatgagcgagagtcaaacagtccttct
ttctttaacatctatgaaatcaacatccttgttgactacttgaagaagctgcttctgaca
cagcccaagaagggaatctcaagaatcttccccaaagacattggcatcatcgccccctac
cggaaacaggtggagaagatcaaacgagccatcgatgcagacaaggacttccaagattac
atgggcattgacaacctgaaagtcggttctgtggaggagtttcagggccaagagaggaaa
gtgatcatggtgtcgactgttcgcagcagtgtaaaatacatcagtttggatgaaacattc
aacattgggtttctcaaaaatgaaaagagattcaatgtggcggtgacaagggcaaaatcg
ttgttaatcatggtgggaaaccccatgattctgcggacagatgaaagctggggccggttt
attgacttctgcttggagcggggtggttacactgggatttccattaccagcgttgagaga
atagatgatgttgaaagtcgtcttcttgctcttaacatccaggacgaggaaaccgaggag
agtccagtccagcggtatgtggatcccgagtttaggaatgattactaa

DBGET integrated database retrieval system