KEGG   Danio rerio (zebrafish): 556158
Entry
556158            CDS       T01004                                 
Symbol
nlgn2a
Name
(RefSeq) neuroligin-2a precursor
  KO
K07378  neuroligin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    556158 (nlgn2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    556158 (nlgn2a)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    556158 (nlgn2a)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9
Other DBs
NCBI-GeneID: 556158
NCBI-ProteinID: NP_001159801
ZFIN: ZDB-GENE-090918-2
Ensembl: ENSDARG00000077329
UniProt: D0EVX0
Position
7:complement(21940857..22245550)
AA seq 810 aa
MYLPHACKRDLGYAHNSEVTHTIALFWLALWITLASCQRIDPGTKYPTVTTNYGKLRGIK
KELNNEILGPVEQYLGVPYATAPIGDRRFQPPEAPGSWQEVRNATQFAPVCPQNVHGVLP
EIMLPVWFTDSLDVAATYIQNQSEDCLYLNIYVPTEDDIRDRRKKPVMLFIHGGSYMEGT
GNMFDASVLAAYGNVIVVTMNYRLGVLGFLSTGDQSAKGNYGLLDQIQALRWLNENIGHF
GGDPERITIFGSGAGASCVNLLILSHHSEGLFQRAIAQSGSAISSWSISYQPLKYTKILA
RKVGCTYGETADLVDCLRRKNFRELVDQDIQPARYHIAFGPVMDGDVVPDDPEILMQQGE
FLNYDLLIGVNQGEGLKFVDDGGTESEEGISAAAFDYTISNFVDNLYGYPKGKDILRETI
KFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAIATAKLHADYQSPVYFYTFYHHCQTET
RPEWADAAHGDEIPYVFGVPMIGATDLFPCNFSKNDIMLSAVVMTYWTNFAKTGDPNLPV
PQDTKFIHTKPNRFEEVIWTKFNSKDKQYLHIGLKPRIRDNYRANKVAFWLELVPHLHNL
HEEVFSTATTRLPPGTARTPHWKGQGPRTTRHPIPTFPSELDPDSSEQPRFPPFPSDTRD
YSTELSVTVAVGASPLFLNILAFAALYYKRDKRHEMRRHRLSPQRGVAANDLAHSQEEEI
MSLQMKHSEHDAHHDMEPLRPHDILRPACPPDYTLALRRAPDDVPLMTPNTITMIPSTIT
GMQPLHAFNTFPTSTGHNNTLPHPHSTTRV
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgtatttgcctcatgcctgtaaacgggatttgggctatgcccacaattcagaggtcact
cacacaatagctctcttctggttggcactgtggatcactttggcatcatgtcaacgcatc
gatcctggcaccaaatatcctacagtcaccacaaactacggcaaattgcgtgggattaaa
aaagagcttaacaatgagattctgggtcccgtggaacaatatctgggcgttccttatgcc
acagcgccaatcggagaccgtcgctttcagccaccagaagctccagggtcttggcaagaa
gtgcgcaatgccacgcagtttgccccggtttgcccgcagaatgttcatggtgttttgccc
gagatcatgctgccggtgtggttcaccgacagcttggacgtggctgccacctacattcag
aaccagagtgaagactgtctctacctcaacatctatgtgcccacagaagatgatatccga
gaccgtaggaagaaaccagtcatgctgttcattcacggtggctcttatatggaaggaacc
ggaaacatgtttgatgccagtgttcttgcagcctatgggaacgtcattgtagtcaccatg
aactacaggctgggagttctaggttttctcagcactggagatcagtctgccaaagggaac
tatgggctgctggatcaaatccaggccttgcgttggctgaatgagaatattgggcacttt
ggaggcgaccctgaacggatcactatctttggctctggggcaggagcatcttgtgtaaac
ctactcatcctgtcccaccattctgagggtctgtttcagagagccatcgctcagagtgga
tcagccatctccagctggtccattagctaccagcccttgaagtacactaagatcctggct
cgtaaagtgggatgcacatatggagagaccgcagacctggtggattgtctccgcaggaaa
aatttcagagagctggtagatcaggacatccagccggcccgctaccacattgcatttggg
ccggtgatggacggagacgtggtgccagatgacccggagattctgatgcagcagggggag
tttttgaattacgaccttctgattggtgtaaatcaaggggaggggctgaagtttgtggat
gatggaggaactgagagtgaagagggcatttcagctgcagcttttgactacaccatctcc
aactttgtggataacctctatggataccctaaaggtaaagacatcctgagggagactatt
aagttcatgtatactgactgggcagacagagacaatggagaaatgcggcgcaagactcta
ctcgcattattcactgatcaccagtgggtggcgccagccatcgctactgccaagctccac
gctgactaccagtcacctgtctatttctacacattctaccaccactgccaaacagagaca
cgacccgaatgggcagacgcagcacatggggatgagataccctatgtgtttggtgtgcca
atgatcggagcaacagatctgttcccttgcaacttttccaaaaatgatatcatgctcagc
gctgtggtcatgacctactggaccaactttgccaagactggggatcccaacttgcctgtt
cctcaggacaccaagttcatccacaccaaacccaaccgcttcgaggaagtgatctggacc
aagttcaactcaaaggacaagcagtatctccacattggcctgaagcctcgaatccgtgac
aactaccgagcaaataaagtcgctttctggctggagctggttcctcaccttcacaacctt
cacgaggaggtcttcagcactgccacaacccggctgcctccaggaacggcccgaacccca
cactggaagggccagggtccccgtacaacacgccatcccatcccaaccttcccgtcagaa
ctagacccagatagttcggagcagcctcgatttcctcccttcccaagcgacacccgggac
tactcgacagaacttagtgtgaccgtggctgttggcgcttcgcccctgttcctcaacatc
ctcgcctttgctgcgctttactataaacgcgacaaacgacatgaaatgcgaaggcaccgg
ttgtctccgcaacgaggcgtagccgctaatgatttagcacacagccaggaggaagagatc
atgtccctgcaaatgaagcactcggagcatgacgcccaccacgacatggagccattgcga
ccgcatgatattttacgtcccgcatgcccacctgactacacattggcgctacggcgggca
cccgacgatgttccactcatgaccccaaataccatcaccatgatccctagcaccatcacg
ggcatgcagccccttcatgccttcaacaccttccccacatccaccgggcacaacaatacc
ttaccccacccccactccaccacccgtgtatag

DBGET integrated database retrieval system