KEGG   Danio rerio (zebrafish): 556528
Entry
556528            CDS       T01004                                 

Gene name
rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    556528 (rdh5)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     556528 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 DMP12
Other DBs
NCBI-GeneID: 556528
NCBI-ProteinID: NP_001025272
ZFIN: ZDB-GENE-050208-411
Ensembl: ENSDARG00000008306
Vega: OTTDARG00000009177
UniProt: Q4V8Y1
Position
22
AA seq 328 aa
MYEFLSNSCPSTYALGTFAILWVLVWFYRDNLKITRVSEKHVFVTGCDSGFGNLLCKRLD
KRGFRVLAGCLTEKGADDLKRAAGPFLKTCILDVTSSASIQKAMEWTKNEVGDKGLWGLV
NNAGRSLPMGPSEWMKIEDFESTLKVNMTGVIETTMTFLPLVKKARGRIVNVASVLGRVA
ANGGGYCISKFAVESFSDCLRRDIQGFGVNVCIIEPGFFKTQVTSLEPIERELHRLWNQL
TPEVKESYGDKYLDKYIWIQRLIMNAICDSDLSKVTNCMEHALLAVHPRTRYSAGWDAKF
LWIPLSYMPACFVDIALKLVMPKPAKGV
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtatgagttcttgagtaacagctgtcccagcacatatgcattgggtacctttgcgatt
ctgtgggttctggtatggttctaccgggacaacctaaagatcactagagtctcagaaaaa
catgtgtttgtgaccggttgtgactctggttttggaaacctactgtgcaaacgcctggac
aaacgtggtttccgcgtcctagccgggtgtcttacagaaaaaggcgcagatgatctgaaa
agagccgcaggacctttcttgaagacctgcattttggatgtgaccagctcggctagcatc
cagaaggctatggaatggaccaaaaatgaagttggagataaaggactttggggtttggtg
aacaacgccggacgttcccttccaatgggtccatcggagtggatgaaaatcgaggacttc
gaaagcacgctcaaagtcaacatgactggtgtgatcgagaccaccatgaccttcttacca
cttgtgaaaaaggcccgtggacggattgtaaatgtggcgtcggtgttgggtagagttgca
gctaatggcggcgggtattgcatttcgaagttcgcagtggagagtttctccgactgtctc
aggagggacattcagggttttggggtcaatgtgtgcatcatcgaacctggtttcttcaag
acgcaggtgaccagcctggagcccatcgagagggaacttcatcgtctctggaaccaactg
actcctgaagtgaaggagagctacggagacaaatacttggataaatacatctggatccag
aggctgatcatgaacgccatctgcgactctgacctcagtaaagtgaccaactgcatggag
cacgctctgctagccgtccacccaagaactcgctacagcgctggctgggatgccaagttt
ttgtggatccccttgtcttatatgcctgcttgctttgtcgatattgccttgaagctggtg
atgccaaaaccagcaaaaggtgtttaa

DBGET integrated database retrieval system