KEGG   Danio rerio (zebrafish): 556724
Entry
556724            CDS       T01004                                 

Gene name
vps52
Definition
(RefSeq) vacuolar protein sorting-associated protein 52 homolog isoform X1
  KO
K20298  vacuolar protein sorting-associated protein 52
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    556724 (vps52)
Membrane trafficking [BR:dre04131]
 Protein recycling
  Others
   EARP complex
    556724 (vps52)
 Endosome - Golgi transport
  Tethering complex
   GARP complex
    556724 (vps52)
SSDB
Motif
Pfam: Vps52 Sec3_C DUF1664 CoV_NSP7 COG2 DUF5740 DUF3440 MscS_porin
Other DBs
NCBI-GeneID: 556724
NCBI-ProteinID: XP_009292454
ZFIN: ZDB-GENE-010430-2
Ensembl: ENSDARG00000099258
Vega: OTTDARG00000032877
UniProt: A0A0R4IY52
Position
19
AA seq 724 aa
MAEALIGGAVHINTSADSVTGAMACITLHDEKSNFDVIPPLNFGDLDITTDELILDEVDI
HIQANLEDDLVKEALKTGVDLRQYSRQVETELQQIEQASIKDYIKESQNIASLHNQITAC
DSILERMEGMLSSFQSDLSSISSEIQTLQQQSVSMNMRLKNRQAVRSQLSQLVDELVVPS
TMISVILDSPVTEQEFLEQLHELNNKINFAKELSFRETLACSDIQDIVDRLKIKAVTKIR
EFILQKIYSFRKPMTNYQIPQNTLLKYRFFYQFLLANERTVAKEIRDEYVDTMSKIYLSY
FKSYSGRLLKVQYEDVADKDDLMGVEDTAKKGFFSKPSLKSRNTIFTLGQRGAILSPAEL
EGPILIPHAAQRGDSRYPYETLFRSQHYALLDNGCREFLFLSDFFMVAGNSALDLFNSIM
GKTLSIFLKNLSTYLSDCYDSIAVFLCIHIILRFRAIVAKRNIPALDKYLEAVLELLWPR
FELILEMNIQSIRNTDPQKLGVLDTRPHYITRRYAEFSSAIVSINQTFPNERTNTLLGQL
QIEVENFVLKMAAEFPSRRDQLIFLINNYDMMLSVLMERAADDSKEVESFQQLLLARTQE
FIEEILSPPFGGMIAFVKESEALMEKGQLDKLKNDEARITQLVRGFSGTWKQSVEALSQD
VMRSFTNFKNGTSIIQGALTQLIQYYHGFHKVLSQPTFRSLAVRSELINLHHLMVEVKKH
KPNF
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcggaggcgctgatcggtggagctgttcatataaacacatccgctgattctgtgacc
ggtgcgatggcctgtataacgttacacgatgagaagtcaaactttgatgtgattcctcca
ctaaattttggtgatctggacatcactacagatgaattaattctggatgaggttgatatt
cacattcaagctaatctggaggatgatctggtgaaagaggcgctgaagacgggtgtggat
ttgaggcagtactctaggcaggtggagactgagctgcagcaaatcgaacaagcatcaatc
aaagactatatcaaagagagtcagaatattgcctctttacacaaccagatcacagcttgt
gactccatactcgagcgtatggagggcatgctgagcagtttccagagtgacctgtcttcc
atcagcagtgaaattcagacattgcagcaacagtcagtcagcatgaatatgagactcaag
aaccgccaggctgtccgcagtcagctcagccagctggtggatgaactagtcgtccctagc
actatgatctctgtgattcttgacagtcctgtaacggaacaggaatttttagagcaactt
catgagcttaataacaaaatcaactttgctaaagagctcagcttcagagagacccttgct
tgctcagatatacaggacattgtagatcgcctcaaaatcaaagctgtcacaaagatccgg
gagttcatcctacagaaaatttactcttttagaaagccaatgaccaactaccagatcccc
cagaacacattactcaagtacaggtttttctaccagttcctgttagccaatgagagaaca
gttgcaaaagagatccgggacgagtatgtggataccatgagcaaaatctacttaagttac
ttcaagtcatatagtggcagactgctgaaagtccagtatgaagatgttgcagacaaagat
gatctgatgggagtggaagatacagccaaaaaaggttttttctctaagccttctctcaaa
agtagaaacaccatttttactctcggccaaaggggggcaatattgagccccgcagagctg
gaggggcccatactaatcccacatgctgctcaaagaggagactccagatacccctatgaa
actctcttccgcagtcagcactatgctttgctggataatggctgtcgagaattcctgttc
ttgtctgattttttcatggtggcagggaattcagcactggacttgttcaacagcattatg
ggaaaaacactcagcatttttttgaagaatctgtctacatacttgtcagactgttacgat
agtattgcagtatttctctgcattcacatcattctgcgcttcagagccatcgtagccaag
aggaatatccctgcacttgacaagtacttagaggctgtgctagaattgttgtggccgaga
tttgagctgattttggagatgaacatccagagtattcgaaacactgaccctcaaaaactg
ggtgtactggataccagaccacactacatcacacgtcggtatgctgaattctcctctgct
attgttagcataaatcaaacatttcctaatgagaggaccaacacacttcttgggcagttg
cagattgaggtggagaactttgtgctgaaaatggcggctgagtttccctctagacgagac
cagctaattttcctgataaacaactatgacatgatgctcagcgtgcttatggagagagca
gctgatgacagtaaagaggttgagagctttcagcagcttttgctggcgagaacacaggaa
tttatagaggagattctttctcctccatttggaggtatgattgcgtttgtgaaggagagt
gaggcactaatggagaaagggcagcttgacaaactcaaaaatgatgaagctcgtattact
cagttggtgcggggattctccggcacatggaagcagtctgtggaggccctgagtcaggat
gttatgcgctccttcaccaactttaaaaacggaaccagcataattcagggagcgctgacc
cagctcatccagtactatcatggtttccataaggtcctctcccagccaacattccgcagt
ctggcagtgcgctctgagctcataaaccttcatcatctgatggtggaagtcaagaaacac
aaaccaaacttttga

DBGET integrated database retrieval system