KEGG   Danio rerio (zebrafish): 557205Help
Entry
557205            CDS       T01004                                 

Gene name
phykpl
Definition
(RefSeq) 5-phosphohydroxy-L-lysine phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00564  Glycerophospholipid metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    557205 (phykpl)
Enzymes [BR:dre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     557205 (phykpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 DUF3301
Motif
Other DBs
NCBI-GeneID: 557205
NCBI-ProteinID: NP_001032646
ZFIN: ZDB-GENE-051127-33
Ensembl: ENSDARG00000040566
Vega: OTTDARG00000022946
UniProt: Q2YDQ8
Position
15
AA seq 447 aa AA seqDB search
MAVELFHKNETLQMRKKLIAQSCRLFFSHDPVKIVRARGQYLYDENGTQYLDCISNVQHV
GHSHPSITQVAGAQMDLLNTNTRFLHDNIVQYADRLAATLPKKLSVFYFVNSGSEANDLA
LRLARQYTRHQDVIVLDHAYHGHLTSLIDISPYKFRKLEGQKEWVHVAPLPDTYHGIYRE
DHPEPGQAYADTVKSLIEEAHKKGRKISSFFAESLPSVGGQIIFPTGYCKRVAEYVHEAG
GVYVADEIQTGFGRVGSHFWAFQLEGEDFCPDIVTMGKPMGNGHPIACVVTTEEIAGAFT
ANGVEYFNTFGGNPVSCAIGLAVLDVIEKEDLRGNAVRVGGHLKQLLLQLQEKHLLIGDV
RGVGLFIGMELVKDRESREPATEEAAHLVRRLKEDRIVMSTDGPWDSVIKFKPPMCFSKE
DANRVVTCIDQILTELEDVQKEDCGKS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaactttttcacaaaaatgagactttgcaaatgcgcaagaagctgattgca
cagtcctgcagactctttttctcccatgatcctgtgaaaatagtccgagcacggggtcaa
tatttatacgacgagaatggcacgcagtatttagattgcattagtaatgttcaacatgtg
ggtcacagtcaccccagcatcactcaggtggctggcgctcagatggatcttctgaacaca
aacactagattccttcatgataatatagtgcagtatgctgatcgactggctgccactctc
ccaaagaaactttctgtcttctattttgtcaactcaggatcagaggctaacgatctggcc
ttgagactggcccgtcagtacaccagacatcaggatgtgatcgttctagatcatgcatat
catggacatctgacctcgcttattgatatcagcccatacaagttcaggaaactggagggc
cagaaagagtgggttcatgtggcacctctccctgatacttaccacggtatctatcgagaa
gatcatcctgagcctggacaggcttatgcagacacggtcaaaagcctgattgaagaggcg
cataagaaaggtcgcaagatttcatctttttttgctgagtctttacccagcgttggaggt
caaatcattttccccactggatattgtaaaagagtagcagaatatgttcatgaagcagga
ggggtttatgtggcagatgagattcagacaggctttggtcgtgttgggagtcatttctgg
gcgtttcagcttgagggtgaagatttctgccctgacattgtgaccatgggcaaaccgatg
ggcaacggtcatcccattgcatgcgtggtcactacagaggagatcgctggtgcttttaca
gccaatggagtggagtacttcaacacatttggtggtaacccagtgtcctgcgccattggt
ctggcagttttagatgtgatagagaaggaagatctcagaggcaatgcggtgcgtgtcgga
ggtcatcttaaacagctgctccttcagcttcaggaaaaacatctactcatcggagatgtg
cgtggtgttgggctgtttataggtatggagcttgttaaagacagagagtcccgagaacca
gcaacagaagaagcagcacatctagtccgaaggctgaaagaggatcgtatagtgatgagc
acagatggaccatgggacagtgtcatcaaattcaaacctccaatgtgcttcagcaaggag
gatgctaatagagttgttacatgcattgaccaaattcttacagaactggaggatgtccaa
aaagaggactgcggaaaaagttga

DBGET integrated database retrieval system