KEGG   Danio rerio (zebrafish): 557513
Entry
557513            CDS       T01004                                 
Symbol
herc4
Name
(RefSeq) probable E3 ubiquitin-protein ligase HERC4
  KO
K10615  E3 ubiquitin-protein ligase HERC4 [EC:2.3.2.26]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    557513 (herc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    557513 (herc4)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     557513 (herc4)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  HECT type E3
   557513 (herc4)
SSDB
Motif
Pfam: HECT RCC1 RCC1_2 LAIKA
Other DBs
NCBI-GeneID: 557513
NCBI-ProteinID: XP_005173092
ZFIN: ZDB-GENE-070801-1
Ensembl: ENSDARG00000059936
UniProt: E7F700 A0A8M2BKS5
Position
13:complement(50387228..50446630)
AA seq 1052 aa
MLCWGNASFGQLGLGGIDEEVLLEPRRCEFFEGKRVRDVGCGRRHTVFLLEDGTVYTCGC
NDLGQLGHEKARKKPEQVVSLDAQNIVAVSCGEAHTLALNDKGQVFAWGLGSDGQLGLSI
VEDCLRVPRTVKSLSEVHITQVACGYWHSLALARGGEIFSWGQNKYGQLGLGQQGACVCS
PQVIQSLQGIPFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLGLGDNDDRRFPVLLKTLR
SQQVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPRKVFELMGSVVSQIA
CGRQHTLAFIPSSGKIDSFGLGGNGQLGTRSTCNRISPTPVKGCWRAHADPVAMDHSEAE
RSYCVKRIYAGGDQSFAHYALSEDDGPPLDVRITRPAGQIYTLSTELIQKWLNHGLGRIP
AEITDEIDLVFSSASCLNGSFLSSSNPDHYSTSSKCSGVDINTARLLFHKLIQTDHPQIS
QIIAASLEKNLLPKLSSSPPDIEALRLYLTLPECPLLCNPNNFTTLTIPFAKAIVSLKDA
PIKVLGNWWSRFEPVVFQRLVELYKEVVVYLLRMQKLGIPLSEQRIFTCFLDTSLKLLEI
LHSVNERAGQIIQYDKFYIHELDELIDIRNDYATWFQQQMFSVVMDSQVTLCKYPFVFDA
QAKTALLQTDAVIQMQMAVDQAQRQNFTSLFLSGGGVESVNPCLILIVRRENVVGDSMEV
LRKSKNVDYKKPLKVIFVGEEAVDAGGVRKEFFLLIMKELLHPKYGMFRFHEESRLIWFA
CKTFEDIDLFHLIGVVCGLAIYNLTIVELNFPLALYKKLLKKTPTLEDLKELMPDVGRSL
QQLLDYTEDDLEETFCLNFTITEDNFGATEVVELIPNGTDISVNKSNRQEFVNAYVDYIF
NKSVAPQFSAFYAGFHKVCGGKVLELFQPSELQAMVIGNTNYDWKELEKSTEYKGEYWAD
HPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLALVIQPTAGGEQYFPVAHTC
FNLLDLPKYTSKNTMQEKLLHAIEHNQGFNLV
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgttatgttggggaaacgcctccttcgggcagctgggtttaggaggtatcgatgaggag
gtgctgctggagccccgaagatgtgagtttttcgagggtaagcgcgtgcgggacgtgggc
tgcgggagacgccacactgtcttcctgctagaggatgggacggtttacacctgcggctgc
aatgacctggggcagctggggcatgagaaagcccgcaagaaaccagagcaggtggtgtct
ctggatgcgcagaacattgtggcggtgtcgtgtggagaagctcatactcttgctctgaat
gataaaggacaagtgtttgcgtggggtttgggatcagatggacagctcggactttccatt
gtagaagactgtctgcgtgtgcccagaactgtcaagagcttgtcagaggttcacattacc
caggtggcctgtggatactggcattcccttgctttagcccgaggaggcgagatattctcc
tggggccagaataagtatggtcagctgggtctggggcagcagggagcctgtgtctgctct
ccacaggtcatccagtctctgcagggcatcccgttcgggcagatttccgccggtggagct
cacagctttggcctcacgctctctggggccattttcggatgggggcggaacaagttcggc
cagctgggcctcggagacaatgatgatcgccgtttcccagtcttgctgaagactctcagg
tctcaacaggttgtttacatctgctgtggagaggaccacacggcagcgctaacaaaggag
ggcggtgtatttacttttggagctggtggatatggtcagctgggacacaactccacaaac
catgaggtcaaccccagaaaggtgtttgagctcatggggagcgtggtttcacagattgca
tgtggtcggcagcacactctggcgttcatcccttcatcaggaaagatagattcgttcggt
ctcgggggaaacggtcagctgggaacgcgctccacctgcaaccgcatcagtcccacaccg
gtgaagggctgctggagagcccacgctgaccctgttgccatggatcatagcgaggcggag
cggagttactgtgtgaagaggatttatgctggaggagaccagagtttcgctcactacgct
ttatcagaggatgacggtcccccactggatgtgaggataaccagacctgctggacagatc
tacacactcagcactgaactcatccagaagtggctcaatcacggccttggcaggatacca
gcagaaatcacagatgagattgatcttgtgttttcttctgcgagttgtctcaatggaagc
tttctgtcttcaagtaatccagatcactacagcacgagcagtaagtgctcaggtgtggac
attaacacggctcgtctgctcttccacaaactcatccaaaccgatcacccacaaatctca
caaatcatcgctgctagtttggagaagaatctccttcccaaattgagcagttctcctcca
gacatcgaggctctgagactgtacctgaccctgcctgagtgtccacttctctgcaacccg
aacaacttcactacgttaactattcccttcgccaaagccatcgtcagcctgaaagatgct
cctatcaaagtgctcgggaactggtggtcccggtttgagccggtggttttccagaggctg
gtggagctctataaggaggtggtggtgtatctgttgcgcatgcagaaactgggcattcct
ctttctgaacagaggatcttcacctgctttttagacacttcacttaaactgctggagatc
ctgcactcggtcaatgagcgtgccggacagatcatccagtatgataaattctacatccat
gagctagacgagctgatcgacatcaggaatgattatgcgacctggtttcagcagcagatg
ttctctgtggtcatggactctcaggtcaccctctgcaaatacccgtttgtgtttgacgct
caggcgaagacggctctgctgcagactgatgctgtgatccagatgcagatggcggtggat
caggcgcagagacagaacttcacctcattatttctgtccggcggaggcgtggagtcagtg
aacccctgcctcatcctcatcgtacgcagagaaaacgtggtcggagactccatggaggtg
ctgaggaagtccaaaaacgtagactacaagaagccactcaaggtgatctttgttggcgag
gaggctgtggacgctggtggtgtgaggaaagagtttttcctgctcatcatgaaagagctt
ctgcacccgaaatatggcatgtttagattccacgaggagtccaggcttatctggtttgct
tgcaagacgtttgaagatatcgacctgtttcacctgatcggtgttgtctgtggattggcc
atctataatctcactatagtggagctgaatttcccgctagcgctgtacaagaaactgctg
aagaaaacaccaacactagaggacctgaaggagctcatgcctgatgtgggaaggagtctt
cagcagctgctggattatactgaagatgatttggaggaaaccttctgcctgaatttcaca
atcacagaagataattttggagccacagaggtagtggaactgatccccaacgggaccgac
atcagcgtcaacaaatccaacaggcaggagtttgtcaacgcttatgtggattatatattc
aacaagtctgtggctcctcagttcagtgctttctatgctggatttcacaaagtgtgtgga
gggaaagtcctggagcttttccagcccagtgaactgcaggccatggtcatcggaaacacc
aactatgactggaaggagctggaaaagagcaccgagtataagggcgagtactgggctgat
catcccaccatcaagatattctgggaggtttttcacgagctgcctttggagaagaagaaa
cagttcctgttgttcctgacaggcagtgatcgtatccccattctgggcatgaagagtctg
gctctggtgattcagccgaccgcaggaggagagcagtatttcccagtggcacacacatgc
tttaacctgctggatctgcccaaatacaccagcaaaaacacaatgcaggagaagctgctg
cacgccattgaacacaaccagggctttaacctggtctga

DBGET integrated database retrieval system