KEGG   Danio rerio (zebrafish): 557693Help
Entry
557693            CDS       T01004                                 

Gene name
rapgef2
Definition
(RefSeq) rap guanine nucleotide exchange factor 2 isoform X5
  KO
K08018  Rap guanine nucleotide exchange factor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04530  Tight junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    557693 (rapgef2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    557693 (rapgef2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF PDZ RasGEF_N PDZ_6 RA cNMP_binding PDZ_2
Motif
Other DBs
NCBI-GeneID: 557693
NCBI-ProteinID: XP_009289555
ZFIN: ZDB-GENE-030131-6959
Ensembl: ENSDARG00000005482
Vega: OTTDARG00000042015
UniProt: A0A0R4IBW6
Position
14
AA seq 1618 aa AA seqDB search
MASYVDNSFRQAVMVNPSDRTQQDLEIVYSYLHGMEALSNLREHQLRIMCETVRYERHEA
NEVLYYPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSLRRGCECIVLEPSEMIVV
DYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPAGKPPVARGYHTECVKA
QLPADFSRLHLADGIHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEPGDMDLSGLP
ETAVDSEEDDDEEDIERASDPLMSRDIVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFANM
TMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTHPDSRNEILCMGNSF
GVSPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHRE
LDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTYIEDFLLTYRTFLPSPMVVGKRLLEW
FHDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTHFLEEFEYNLEREKMCGHLRLLNIACAA
KAKLRVVTLTKPSREAPLAFTLLGGSEKGFRIFIDSVEPGSKAAEAGLKRGDQILEVNGQ
NFENVPLSKANEILKNNTHLSITVKTNLLVFKELLARPDQDQEQEQEEEPDRKNGAPHIP
KIGDIKKASRYSIPDLAVDVEQVMDLEKASKKAKANSAGGRNKLKKIFDKTLTSILPPKP
YNDVGVGQSQDDSIVGLKQSKQIPPALPVSGNLSSSNPDLLQSHHRILDFNNQPEAVPIN
MSDQVLRVFKADQQSRYIMIGKDTTAKEVVAQAIREFALTAAAEAYSLCEVSVTPEGVIK
QRRLPEQLSKLADRIQLSGRYYLKSNMETETLCSDEDAQELLRESHISLLQLSTVEVATQ
LSMRAFELFCAIEPTEYIDDLFKLKTRLTGPPSLKLFEEAINRETFWVATEVVREANQLK
RMKIVKHFIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFSDLQDL
FDPSRNMAKYRNLLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKE
IRHVGRMAAVNMDPALMFRTRKKKWRSLGSLSQGSANAAVLDVTQTGGHKKRVRRSSFLN
AKKLYEDAQMARKVKQYLSNLTLETNEESLQTLSMQCEPSINTLPKSSGDRKRPDTSPVV
SRAATHQRQQLQKANQALQVPAVALYPSRKKVPVKDLPPFGTSSPQSLKKILSLSEEAGD
RHRKQAEDSVSNNSSQLSSPPTSPHSSPKKAIASIRSHGMKGFSSLCSKSPTGYGRAGDY
LSDSGHSEISSRSSLVSTSSLDMGQDERRQRYGGTAGEGHGSGHRLERRATADPDQYSLG
SYSSMQDCRGLYAGATVLSSPSSEELTQDQGDRVSLDAADSGRGSWTSCSSGSHDNIQTM
QQGRSWEALAEGAGLWGSRGSWASACSSSSSVACWGEDSEGDTGTIKRRGGRDVTTDPET
SSITSTGSEESRQHSRRPSPITAGNTKASITRKDGRYRDPPPTPPGYTALTITDVTEGTP
HSGRKPPDYTTALQRSRLVTHSLDSQQPPAAGKPDPRGREEDEAVEVEEEEDEQVSAV
NT seq 4857 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctatgtggataacagttttcggcaggcggtgatggtgaatccgtcagacagg
acgcaacaggacctggagatcgtttattcatacctgcatgggatggaggctctgtccaac
ctccgcgaacaccagctgaggataatgtgtgaaacggtccgctacgaaagacacgaagcc
aacgaagtgctgtattatccagatgacattggcacatgctggtacattctactttccgga
tcggttttcatcaaagagtccatgttcttgccacgctccagtttcgggaagaggtctgcc
gggagtttgcgtcgtggatgcgagtgcatcgttctggagccgtccgagatgattgtggtg
gactatatggatgagaatgaggagtatttccagcggcaggcatcgcaccgacagtcacgc
cgacgctttcgcaagatcaaccagaagggcgagcggcagaccatcatcgacaccgtagac
ccctatcctgctggcaagccccccgtggcgcggggataccatacggaatgtgttaaagct
cagctgccggcagacttcagcaggttacacctggcagacgggattcaccctcaggtgaca
cacgtgtcctccagtcattcaggatgtagcatcaccagtgactctggaagcagcagcctg
tcggacatttaccaggccaccgagagtgagccgggcgacatggacctcagcggtctgcct
gagacggccgttgactccgaggaggacgatgatgaggaagacatcgagcgtgcctcagat
cccctcatgagccgagacatcgtccgagactgcctggagaaagaccccatggaccgaaca
gatgatgacatagagcaactgttggagttcatgcaccagctaccagcctttgccaacatg
accatgtctgtcaggagggagctgtgtgctgtcatggtgttcgctgtggtggaacgggcc
ggcaccatcgtccttaatgatggcgaagagctggactcgtggtctgtgattctgaatgga
tcggtggaagtgacgcatccagacagccgcaatgaaatcctctgcatgggcaacagcttc
ggcgtttctcccaccatggagaaagagtacatgaagggggtgatgaagaccaaggttgat
gactgccagtttgtgtgcatcgctcagcaggattactgctgcatcctcaaccaggtggag
aagaacatgcagaaggtggaggaggaaggagagatcgtgatggtgaaggagcacagagag
ctggaccgcacaggcaccaggaaagggcacatcgtcatcaagggcacatcagagcgtctc
accatgcaccttgtagaagagcactcagtggtcgacccgacttacatcgaggacttcctg
ctcacctaccgcaccttcctgccgagccccatggtggtgggcaagagactgttggagtgg
tttcatgaccccagcctcagggacaaggttacacgggtagtcttgctgtgggtgaacaat
cactttaatgactttgagggcgaccctgcaatgacacattttctggaggagttcgagtac
aatctggagagagagaaaatgtgtggccacctaagactgttaaacatagcatgtgctgcc
aaagctaagctgcgtgtggtgaccctgaccaaaccctcgagggaagccccgctggccttc
accctgctgggcggctccgagaagggctttcgcatcttcatcgacagcgtggaacccggc
agtaaagctgcagaggccggccttaaaagaggagatcagatactggaggtaaatgggcaa
aactttgaaaatgtgccgctatccaaagccaacgagattctcaaaaacaacacgcacctg
tccattactgtgaaaaccaatctcttggtgtttaaggagctgctggccaggcctgaccag
gatcaggagcaagaacaagaagaggagcccgaccggaaaaacggggctccgcacatccct
aaaatcggggacattaagaaagccagccgctactccatccctgacctggctgtggacgtg
gagcaggtcatggatctggagaaagccagtaagaaagccaaggctaacagcgcaggcgga
agaaacaagctgaagaagatcttcgacaagacactgaccagtattcttccacccaaacct
tacaatgacgttggggtgggacagtcccaggatgacagtattgtgggcctgaagcagtca
aagcagattcctcctgctctccctgtcagtggaaacctttcatcaagcaaccctgacctg
ctgcagtcacaccatcgcatactcgacttcaacaaccagcctgaagcggtccctataaac
atgtcagaccaggtattgcgagtgttcaaggcggaccagcaaagtcggtacatcatgatt
gggaaggacaccacggcaaaagaagtggtggctcaggccatccgagagttcgccctcacc
gctgctgccgaagcctattcgttgtgtgaggtgtcagtcactcccgaaggagtcatcaag
caaaggagactccctgaacaactctccaaactggctgacaggatccagctgagtggaagg
tactacctgaaaagcaacatggagacagagacactgtgctcggatgaagatgcgcaggag
ttgctacgagagagccatatcagcctgctgcagctcagcacggtggaagtggcaacccaa
ctctccatgcgcgcctttgagctgttctgtgccatcgagcccaccgagtacatcgatgac
ctgtttaagctgaaaactcgcctcaccggaccccccagcctcaagctttttgaggaggcc
atcaatcgggagactttctgggtggccacagaggtggtgcgagaggccaaccagctcaaa
cgcatgaagattgtcaagcacttcattaagattgcactgcactgccgcgaatgcaagaac
ttcaactccatgtttgccatcatcagtggtctgaacttggcaccagtgtccaggctgaga
ggcacatgggagaagctgcccagcaaatacgagaagctgtttagcgatcttcaagacctc
ttcgatccctccaggaatatggccaagtatcgcaaccttctaaacagccagaacctgcag
ccccctatcatcccactcttccccgtaatcaagaaggatctcactttcctgcatgaaggg
aatgactccaaagtggacggtttggtgaactttgagaagctgcggatgatcgctaaagag
atccgacacgtgggcagaatggcagccgtaaacatggaccctgcactgatgttcagaacc
aggaagaagaaatggaggagtttagggtcactcagccagggcagtgccaacgcggctgtc
ctggatgtgacccagacgggtgggcacaagaagcgggtcagaaggagttccttccttaat
gccaagaagctgtacgaggacgcacagatggcacgcaaagtcaaacaatacctgtccaac
ctcaccctggagaccaacgaggagagcctgcaaacgctctcaatgcagtgtgagccctca
atcaacaccttgccgaagagttctggggacagaaagagacccgacacatcacccgtagtc
tcacgggctgcgacccaccagcgccagcagcttcaaaaagccaaccaggcgcttcaagtg
cctgccgtagccctctacccatcccgcaaaaaagtgccagtcaaagacttaccgccattt
ggcacaagctcaccacagtctctgaagaagatcctgtccctttcagaggaggcaggagac
agacaccgaaagcaggcagaggacagtgtgtccaacaactcctcacagctctcgtctcct
ccaacatctcctcacagctcacccaaaaaagccatcgcatcaataagaagtcatggtatg
aagggcttttcctccttgtgtagtaaatcaccaacaggttatggacgagctggtgattac
ctgtccgactctggccacagtgagatctcctcccgctccagtctggtgagcacttcttct
ctggacatggggcaggacgagcgccggcagcgttacggaggaacggccggagaaggacac
ggcagtggccaccggctcgagcgcagagctactgctgaccctgaccagtacagcttgggg
tcctactcctccatgcaggactgtcgtggtctgtacgcaggcgccaccgtcctgtcctca
cccagctcagaggagctcacgcaggaccagggtgaccgggtgtccctggacgctgcggat
tccggtcgtggcagctggacttcgtgctccagcggctctcatgataacatccagaccatg
cagcagggccgcagctgggaggcgctggcagagggcgcaggcctgtggggcagcagaggg
agctgggcatccgcatgctcctcttcttcttcggtggcatgttggggcgaggactctgaa
ggcgacactggcaccatcaaacggagaggagggagggatgtgaccacagatccagagacc
agcagcatcacctccaccgggtcggaagagtccagacagcacagccgacggccctcaccc
atcaccgcaggaaacaccaaggcttccatcacacggaaggacggccgctatcgggaccct
ccaccaacgccgccgggttacaccgcgctgaccatcacagatgtgaccgagggaacgcca
cattcgggcaggaaaccaccagactacaccaccgccctgcagcgctcgcgcctcgtcaca
cactccctcgactcccagcagcccccagccgcagggaaaccggacccccggggccgagag
gaggacgaggcagtggaggtggaggaggaggaggatgaacaagtgtctgctgtctga

DBGET integrated database retrieval system