KEGG   Danio rerio (zebrafish): 557863
Entry
557863            CDS       T01004                                 

Gene name
kif17
Definition
(RefSeq) kinesin-like protein KIF17
  KO
K20198  kinesin family member 17
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    557863 (kif17)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     557863 (kif17)
SSDB
Motif
Pfam: Kinesin Microtub_bd Kinesin_assoc YolD BBP1_C AAA_16
Other DBs
NCBI-GeneID: 557863
NCBI-ProteinID: NP_001373250
ZFIN: ZDB-GENE-080724-12
Ensembl: ENSDARG00000055238
Vega: OTTDARG00000035634
Position
11
AA seq 823 aa
MASESVKVVVRCRPLNNREKAMNCKIVVSVDSTHCQCFIKKPGDTEEPPKQFTFDGTYYI
NHSTEEVYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGVPDPPSQRGIIPRAFEH
IFETIQCAENTKFLVRASYLEIYKEEIRDLLGKDIKQKMELKEHPERGVYVRDLTMQTVH
SVGECERVMDLGWRNRSVGYTLMNKDSSRSHSIFTIHLEICSIDTAGDEHLRAGKLNLVD
LAGSERQSKTGATGDRLQEATKINLSLSALGNVISALVDGRSKYIPYRDSKLTRLLQDSL
GGNTRTLMVACLSPADNNYEESISTLRYANRAKSIQNRPRINEDPKDALLREYQEEIKKL
RALISGQLGSGNLSSFLAGQKSGEASAVVSRPQSNTSESEAEKDKIKEEYEKKLARLQAE
YDAEQESKVKLQEDIAALRTSYETRLSSLERSRGSRTHTTGGVHLQQHKEEPITASAASQ
EQAKIDHSESEERPSSVDATVKGAASGESQILDSVVVDIPGQLDQKLALERLQQLEQEFV
GGEQVRNEELKQRHKQRKTLADQRKKQLIEALNQSSEDGDSVLLNVYDSIQEEVHAKSRH
LENTQKKLKAAKLEIRDLQAEFEMERNDYLATIRRLEREGQLLQGILERMVSLVRRDCNY
SNLDRLRKEAVWDEEGGTWRLPDVLVQKTTLPAVPPSGVIAPGRLSARRNSASDLADPFV
QEEEQDRYKEMLNRSDSEHIATNYFRPKRSSQLLATDSVKNSMNFSSSVSNGSAHQSSSG
SGLSALTVESILPRPFRLESLGVPASHGKVKRKKSKTLISTDY
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggcatcagagtccgtgaaggtggtcgtcagatgtcggcctttaaacaacagagagaag
gcgatgaactgtaaaattgtggtgtccgttgacagcactcactgtcagtgtttcattaag
aaacctggggacacggaggagccccctaaacaattcacgtttgacgggacttattatata
aaccactccactgaagaggtctacaacgagatcgcgtatcctctggtggagggtgtaact
gagggctacaatgggaccatttttgcttatggacaaacaggcagcggcaagtcgtttaca
atgcaaggtgtaccagatcctccttcccagagaggaatcatccctagagcttttgagcac
atctttgagacaatccagtgtgctgagaacacgaaattccttgtacgagcctcttacctg
gaaatatacaaagaggaaatcagagatcttttgggaaaagacatcaaacagaagatggag
ctgaaggagcatcctgagcgtggagtttatgtgcgggatctgaccatgcagacggtgcac
agtgttggggaatgtgagcgggtgatggatcttggctggaggaatcgttctgtgggatac
acactcatgaacaaagactcctctcgctcgcactccatattcaccattcacctggagatc
tgcagtatagatactgctggtgatgaacatctgcgcgctgggaagctcaacctggtggat
cttgccggtagcgaacgacaatcaaaaactggtgctactggagatcgtcttcaagaagcc
accaagatcaacttgtctctttcagcccttggcaatgtcatatctgcattagttgacggt
cggtcgaaatacatcccatatcgcgattctaagctgacccgtttgcttcaggactctctg
ggcggaaatactcgtacccttatggtggcctgtctgtcgcctgccgacaacaattacgag
gagagcataagtactctacgttacgccaaccgcgcaaagagcatccaaaatcgtcctcgc
atcaatgaggacccgaaagatgccctcctgcgcgagtaccaggaggagatcaagaagttg
cgggctttaatctctgggcaactgggatctggcaacctcagctcgtttttggcaggtcag
aagtcaggagaagcttcagctgttgtatcgagaccccagagcaacacatcagagagtgag
gcagagaaagataagataaaagaggaatatgagaagaaactggcgaggctgcaggcagag
tatgatgccgaacaagagtctaaagtcaaactccaggaggacatcgctgccttgagaaca
tcatatgagaccaggctctcttctttagaaaggtccagaggtagtcgaacacacaccact
ggtggtgttcatctgcaacaacataaagaagagcccatcactgcatctgcggcttcacaa
gaacaggctaagattgaccacagtgaatctgaggagagaccgtcttctgttgatgccact
gtcaaaggagctgccagtggagaaagtcaaattttagattcggttgtagttgacatacca
ggtcagctggaccagaagcttgctttggagaggctgcagcagctggagcaggagtttgtg
ggtggcgagcaggtgaggaacgaggagctcaagcagagacacaaacagaggaagactctg
gccgaccagaggaagaagcagctgatcgaagctctgaaccagagcagtgaagatggtgac
agtgtgctgctgaacgtatacgactccattcaggaggaagtccatgccaagagcagacat
ctggagaacacgcagaagaagctaaaagctgccaagctggagatcagagaccttcaggca
gagtttgagatggagagaaatgattatctggccaccatccggcgtctggagcgggaaggc
cagctcctacaaggaattttggagcgtatggtgtcccttgtgcgcagagactgcaactac
agcaacctggatcgtctgcggaaggaggcggtgtgggatgaagagggaggaacctggaga
ctgccggatgtgctggtgcagaaaacaaccttacctgcagtgcctccttctggtgtcatt
gctcctggcaggctttcagcacgcaggaattctgcctcagatctcgctgacccttttgtg
caggaagaggagcaggaccgctacaaagaaatgctgaaccgcagtgatagcgaacacatt
gccaccaactacttcagaccaaaacgaagcagtcagctgctggccaccgactctgtgaaa
aactcaatgaatttttcttcttcagtcagtaatggctcagcccaccagagctccagtggg
tcaggtttatctgcgctaactgtagaatcgattcttccacgtcccttccgtttagagtct
ctgggagttccggcttcacacggcaaagtaaaacgcaaaaagagcaagactcttatttca
acagattactag

DBGET integrated database retrieval system