KEGG   Danio rerio (zebrafish): 557960
Entry
557960            CDS       T01004                                 

Gene name
lman2
Definition
(RefSeq) vesicular integral-membrane protein VIP36 precursor
  KO
K10082  lectin, mannose-binding 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    557960 (lman2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    557960 (lman2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:dre04091]
    557960 (lman2)
Membrane trafficking [BR:dre04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    557960 (lman2)
Lectins [BR:dre04091]
 L-type lectins
  557960 (lman2)
SSDB
Motif
Pfam: Lectin_leg-like Bact_lectin UL42
Other DBs
NCBI-GeneID: 557960
NCBI-ProteinID: NP_001075216
ZFIN: ZDB-GENE-070209-149
Ensembl: ENSDARG00000061854
Vega: OTTDARG00000016653
UniProt: A5PMC4 A2RV32
Position
14
AA seq 354 aa
MTRERSPALWLHPQPSVSRKMPVCHKILLLLWLLHFSSVYSDITDGNAEHLKREHSLIKP
YQGVGSSPSSQWDFWGSTLVTSQYVRLTPDERSKQGSIWNTVPCYLKDWEMHVQFKIHGS
GKKNLHGDGFAMWYTKERLHPGPVFGNQDHFVGLAIFVDTFRNDLQGMDRSFPYISAMVN
NGSLPYEHGKDGRSTELGGCSVEVRNKEHDTYLAIRYSKGRLTIMVDVDDQNDWKECVDI
GGVRLPTGYYFGASAATGDLSDNHDIISMKMYQLMVEHTLEEDSQDWTKIEPSVSLLKSP
KDNIDDPTGNFRSSPLTGWKVFLLLLCALLGIVVCAVVGAVVFQKRQERNKRFY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacacgagaaagaagccctgctctatggcttcaccctcaaccaagtgtttctcgtaaa
atgccggtgtgtcacaaaatactcttacttttatggctacttcacttttcttccgtatat
tcagatataacggacgggaatgcggagcacttaaagcgggagcactcgctcattaagcca
tatcagggtgttgggtcgagcccttcaagtcagtgggacttttggggaagtactttagta
accagccagtatgtgcgcctgactccagatgagaggagcaaacaaggctccatctggaat
acagtgccatgctatttgaaggactgggagatgcatgtgcagtttaaaattcatggatca
ggaaagaagaatctccatggggacggctttgccatgtggtacacaaaggagagactacat
cctggcccagtctttggaaaccaagaccattttgtaggcctggctatttttgtggatacc
ttccgtaatgatctccaaggaatggatcgctcctttccatacatttctgcgatggtcaat
aacggctccctgccgtatgagcacgggaaagatggtcgctctactgaattgggaggttgc
tctgttgaagttcgaaacaaagaacatgacacataccttgctattagatactccaaaggc
agactcacgataatggtggatgtggatgatcagaatgactggaaagagtgtgttgatatc
ggtggtgttcgccttcctactggatactattttggtgcgtccgcggccacaggagatctg
tctgataatcatgacatcatctccatgaagatgtaccagctgatggttgaacacactctt
gaggaggacagtcaggattggactaagatcgagcccagcgtcagtctcctcaagtcgcca
aaagataatattgacgatccaactggaaattttcgaagctcacccctcaccggctggaag
gtcttcctacttcttctttgtgccctgttgggaattgtggtttgtgccgtggttggtgct
gtggtctttcagaagcgccaggagaggaacaagaggttctactaa

DBGET integrated database retrieval system