KEGG   Danio rerio (zebrafish): 558088Help
Entry
558088            CDS       T01004                                 

Gene name
cpt1aa
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00071  Fatty acid degradation
dre01212  Fatty acid metabolism
dre03320  PPAR signaling pathway
dre04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    558088 (cpt1aa)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    558088 (cpt1aa)
   03320 PPAR signaling pathway
    558088 (cpt1aa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dre03029]
    558088 (cpt1aa)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     558088 (cpt1aa)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    558088 (cpt1aa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 558088
NCBI-ProteinID: NP_001038319
ZFIN: ZDB-GENE-060503-925
Ensembl: ENSDARG00000059770
Vega: OTTDARG00000011679
UniProt: A0A1L1U0X8
Position
7
AA seq 774 aa AA seqDB search
MAEAHQAVAFQFTVGPDGIDLQLSHEALRQVYLSGIHSWKKKFIRFKNGILNGVYPGSAP
GFVLVLAGYLGRAQYLKVDPSLGLLFKLGNYVPISRYMSEQKQMLVGGVMVGTGLWIAII
FGMRTVLKGLLSWHGWMFASHGRMTWKIRLWLVFVKVFSGMQTPMLYSFQNSLPHLFVPS
VKETTRRYLESVQPLLSDEEHQRMQRLALDFERNLGPKLQWYLKLKSWWATNYVSDWWEE
YIYLRGRGPIMVNSNYYVMDFLYAFPTNIQAARAGNVIHAIMLYRRKLDRAQIKPVFALS
NSVPLCSAQWERLFNTSRIPGKERDSVQHVSDSRHIVVYHRGRYFKVWMFYDGRLLLPRE
IEQQMERILADTSEPQPGEETLAALTAGDRVPWACARNAYLRHGTNKKSLDSVEKAAFFV
TLDDTEQRFDQKNPVESLDRYAKSLLHGKCYDRWFDKSINLIIFKNGTMGLNAEHSWADA
PIVGHLWEQVLSMDPVKLGYTEDGHCKGEPHANLPGPQRLQWNIPTECQTMITNSLSVAE
ALADDVDSHIIPFSDFGKGLIKKCRTSPDAFIQLALQLAHYRDKGKFCLTYEASMTRLFR
EGRTETVRSCTTESCAFVRAMNSNHTREQKLQLLKNAAEKHQQMYRLAMTGHGIDRHLFC
LYVVLKYLGQDSPFLKEVLSEPWRLSTSQTPLQQGELFDLVKNPEYVTSGGGFGPVADDG
YGVAYVIVGEKLINFHISSKRSSPETDSHRFGNNIRRAMIDMLDLFQLDKKDPK
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcatcaggctgtggcctttcagttcaccgtcggcccggatggcattgac
cttcagctcagccatgaggctcttcggcaagtctatctctcaggaatacactcctggaag
aagaaatttatccgatttaagaatggcattttgaatggggtatatccaggaagcgcacca
gggttcgtgctggtgttggcagggtaccttggaagggcacaatatttaaaagtggaccca
tccttaggcctgctcttcaaacttggcaattatgtcccgatcagtaggtacatgtccgaa
caaaagcagatgttagttgggggtgtcatggtgggcacaggtctgtggattgccatcata
ttcggcatgaggactgttctgaagggtctgttgtcctggcacggctggatgtttgcctct
catggcagaatgacctggaaaattcgactgtggctggttttcgtaaaggttttttctggc
atgcaaacaccaatgctttacagctttcagaattctcttcctcatttatttgtgccatcc
gtgaaggaaaccacaagaagatatcttgaatctgtccaaccactgctgagcgatgaggag
caccaaagaatgcagagacttgcactggattttgagaggaaccttggaccaaaacttcag
tggtacctcaaactgaagtcttggtgggccaccaattacgtcagtgactggtgggaagaa
tatatctacctgagaggtcgtgggccaatcatggttaacagcaactattatgtaatggac
tttctttacgcttttcccacaaatattcaagcagcaagagcaggaaacgtcattcatgca
ataatgctgtacaggaggaagctggaccgggctcaaatcaaaccggtttttgcactatca
aacagcgttccactctgttctgctcaatgggaacggctatttaatacaagccgcatccca
ggaaaggagagggactcagtacagcacgtgtctgacagcaggcatatagtggtgtatcac
cggggccgttactttaaagtatggatgttttatgatggccggttactcctgccaagagag
attgagcagcagatggagaggatcctggccgacacgtccgagcctcagcctggagaggaa
accctggccgccctcaccgcaggggacagagtgccatgggcttgtgcccgcaatgcctac
ttgcgacatggcacgaataagaagagtctggattctgtggagaaggcagctttttttgtt
acactggatgacacagagcagagatttgatcagaaaaaccctgtggagtctctggaccgt
tatgctaaatcactgctccatggcaagtgttatgacaggtggtttgataagtccataaac
ttgatcatcttcaagaatggaacaatgggtcttaatgcagaacacagttgggctgatgct
ccaatcgtcggccacctctgggagcaagtactctcgatggaccctgtgaaactgggctac
acagaagatggtcactgtaaaggagaacctcacgctaatctacctggacctcagaggttg
cagtggaacatcccaactgagtgccaaactatgatcaccaactctctgtctgtggccgag
gccttggctgatgatgtggactctcacatcatccccttcagtgactttggtaagggcttg
atcaagaagtgcaggaccagtccagatgccttcatccagctcgcactgcagctggcacac
tatagggacaaaggaaagttttgcttgacctacgaggcgtccatgacccgtttgttcaga
gaaggtcgtactgaaactgtgcggtcttgcactacagagtcctgtgcttttgttcgtgcc
atgaacagcaatcatacgagagaacaaaagcttcagttactgaaaaatgctgctgagaaa
caccagcagatgtacagactggcgatgactggtcatggcattgatcggcatctcttttgc
ctttatgtggtgttaaagtaccttggacaggactctcctttcctcaaagaggtgctgtca
gagccttggagactgtccaccagtcagactcctctacagcagggggagctgtttgacctg
gtcaaaaacccagagtatgtgaccagcggaggaggctttggacctgttgcagatgatggt
tatggtgtggcttatgtgattgttggagaaaaactcatcaatttccacatctcttccaaa
cgttccagtccagagactgattctcatcgcttcggaaacaatatcagacgcgcaatgatt
gacatgttggatctgtttcagcttgacaaaaaagacccaaagtga

DBGET integrated database retrieval system