KEGG   Danio rerio (zebrafish): 558299
Entry
558299            CDS       T01004                                 
Symbol
slc24a1
Name
(RefSeq) sodium/potassium/calcium exchanger 1 isoform X1
  KO
K13749  solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    558299 (slc24a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    558299 (slc24a1)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   558299 (slc24a1)
SSDB
Motif
Pfam: Na_Ca_ex BUD22 NOA36
Other DBs
NCBI-GeneID: 558299
NCBI-ProteinID: XP_009291877
ZFIN: ZDB-GENE-060503-191
Ensembl: ENSDARG00000041431
Position
18:19006358..19039390
AA seq 741 aa
MFLTRRKRLHLSRIIFLLSGVFLCSLYQLTIRARLPDPWPEPQRAGDPEDGSGLALEGGL
SEMPEVMTNSTTVHPKNSDEVRSSETVTNAPVLTTSTTTEAPSTTTNRTIVHCIYVDPDL
PKPTPVPTPATETTTLVPNTTAPQPGDAPHMKGEYPEDIFSIEDRRKGWVSLHIFGMVYM
FVSLAIVCDEFFVPTLGVITDKLAISDDVAGATFMAAGGSAPELFTSLIGVFISHSNVGI
GTIVGSAVFNILFVIGMCALFSREMLHLTWWPLFRDVSFYILDLIMLIIFFLDNTIMWWE
SMMLVGGYALYVTFMKFNVQLERAFKSQLSKHKSIVKVIAVEEPEKDNGTSGEENRPPEP
EDKNRLKLKPTLQRGGSSASLHNSTMRNTIFQLMIHTLDPLGEESVFNGDAKARSSLECK
VKFKDKAQILNDMARGKVENKKKEKSGEGDDQSEQTKDSKDAPPGAKDEDTNQKSEAQKD
GDIAAGGGSENPGGSDNSGDDDEDDSDEESDDDDDDDDDDDDDDDENEDEAGEDGDEPLS
LEWPDTRRKQATYLFLLPIVFPLWLTVPDVRNPASKKFFVITFLGSIVWIAIFSYLMVWW
AHQVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITMGL
PVPWLMFSFFHSFAPVPVSSNGLFCAIVLLFLMLLFVIISIAACKWRMNKVLGFTMFILY
FVFLVLSVMLEDRIIVCPVSI
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgttcctgactcgaaggaagagacttcatctcagccggattatatttcttctgtccggg
gttttcctttgctctttatatcaactcacgatcagagccagacttccagatccctggccc
gaaccccaaagagccggagaccctgaggatggctctggacttgccctggaaggaggactg
tcagaaatgccagaagtcatgactaattcgaccactgttcacccaaaaaactcagatgaa
gttcgttcatcagagacagtaaccaatgcacctgtcctaacaacatctactacaactgag
gcaccttccacaacaacaaacaggacaatcgtccactgtatctatgtggatccagacctc
ccaaaacccactccagttccaactccagcaactgaaacgaccactctggtgcccaacact
accgcgccccaacctggagatgcaccacacatgaagggcgagtatccggaggacatcttt
tccattgaggatcgacgcaaaggctgggtctctctccatatttttggaatggtatacatg
tttgtttctttggccatcgtctgcgacgagttttttgtcccaactttaggggttataaca
gacaaactggccatctctgatgatgtagccggggcgacgttcatggccgctggaggctca
gctcctgaacttttcacctctttgattggagtcttcatttctcatagcaatgtgggcatt
gggaccatcgttggctcggctgtttttaacatcctcttcgtaattggaatgtgtgcactg
ttttcacgcgagatgcttcacctcacctggtggcctctctttcgggacgtgtccttctat
atcctggatctcatcatgcttatcatcttcttcctggacaacaccattatgtggtgggag
agcatgatgctggtgggaggttatgctctatatgtaaccttcatgaagttcaatgttcag
ttagagcgcgcctttaagtctcagctcagcaaacacaagagcatcgtcaaagtcattgcg
gtggaagaaccagagaaggataatggaacctcaggtgaagagaacaggccacctgaacca
gaagacaagaatcgattaaagctgaagcccacactgcagcgcgggggcagttcagcctct
ctgcataacagcaccatgaggaacaccatcttccagctgatgattcacactctggatcct
cttggagaggagtcagtgtttaatggagatgcaaaggctagaagctctttggaatgtaaa
gtgaaatttaaagacaaggctcagattttgaacgacatggcccgggggaaggtagagaac
aaaaagaaggaaaaatctggtgaaggtgatgatcaatcggagcagaccaaggattcaaaa
gacgcgcctccaggagccaaagatgaagacaccaatcagaagtctgaggcacaaaaggat
ggagacattgcagcaggaggaggttctgaaaatccaggaggttcagacaattcaggggat
gatgatgaagatgacagtgatgaagagagtgatgatgacgatgacgacgatgatgatgat
gacgacgatgatgatgaaaatgaagatgaagctggggaagatggagatgaaccgttgtct
ttagagtggccggacaccagacgtaaacaggccacgtatttgtttttgctgcccattgtc
tttccactgtggctgaccgttccagatgtcagaaaccctgcatccaagaagttcttcgtc
attacctttcttggctcaatagtgtggattgctatattttcctatctgatggtgtggtgg
gcacatcaggttggcgagaccattggcatctctgaggagatcatgggtcttactattctg
gctgccggaacatcgattcctgatttaatcaccagtgtgattgtggcaaggaaaggcttg
ggagacatggctgtctccagctctgtaggcagcaacatatttgacatcaccatggggctg
ccggtgccctggctgatgttctcgttcttccattcctttgccccggtgcccgtgagcagt
aatggtctgttctgtgccatcgtgctgctcttcctcatgctcctcttcgtcattatttcc
atcgctgcctgtaaatggaggatgaacaaagtgctgggcttcaccatgttcatcctctac
tttgtgttcctggtgctcagtgtcatgctggaggatcgaatcatcgtgtgtcccgtctcc
atctga

DBGET integrated database retrieval system