KEGG   Danio rerio (zebrafish): 558314Help
Entry
558314            CDS       T01004                                 

Gene name
dapk1
Definition
(RefSeq) death-associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    558314 (dapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    558314 (dapk1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     558314 (dapk1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   558314 (dapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Ank_2 Ank_4 Pkinase_Tyr Ank_5 Ank_3 Ank Death Kdo COR Roc RIO1 RsgA_GTPase ABC_tran O_Spanin_T7 APH AAA_29 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 558314
NCBI-ProteinID: NP_001093460
ZFIN: ZDB-GENE-060526-177
Ensembl: ENSDARG00000060093
Vega: OTTDARG00000018597
UniProt: A5WVL9
Position
5
AA seq 1439 aa AA seqDB search
MTVFNQENVEDYYEIGGELGSGQFAVVKKCRHKSTGVEYAAKFIKKRRSKSSRRGVSKDD
IEREVSILKEIQHPNVITLHDVFENKHEVILILELVAGGELFDFLAEKESLSEEEATEFL
KQILDGVSYLHSKRISHFDLKPENIMLLNRNVPHPRIKLIDFGLAHKIDFGNDFKNIFGT
PEFVAPEVVNYEPLGLEADMWSIGVITYILLSGASPFLGENKQETLANVSAVDYEFDEDY
FSHTSALAKDFIARLLIKDPKKRMTILDSLQHPWIKPKDTQQALSRKESAVNMEKFKKFA
ARRKWKQSVRLISLCNRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
KHLLGSLTSYDINQPNKHGTPPLLIAAGCGNVQIIDVLMKKGAEIQAFDKTGASAIYYAA
RHGHVGTLRFLHEKKCPLDIQDKSGETALHVAARYGNVDVVQYLCSIHANPDLLDREQET
PLHCAAWHGYSAVARALCEAGCDVNARNREGESPLLTASARGFKDIVECLLEHGADMDSA
DKDGHIALHLAVRRCQVEVVKCLLSHHCYVDHQDRHGNTPLHIACKDANMPVVTQLCAAK
ANLDIPNKFGRTPLHLAASNGGLEVVRHLCLSGANTEAITNDGKTAEDLATAEQQEHVAV
LLAKLKKDNHKSIYIQQLRPTQTLQHRLKLKLFGHSGAGKSTLVESLKCGILRSFFRRRR
TRLTNPVRHPASPVTSKPAVSVSISNLYPGCENVSVRSRSMMFEPSLTKGVLEVFSPVHN
ALSTADDTATKAIDIQNANVNGVGDFSIWEFSGNPVYYCSYDYFAANDATAIHLVLFSLE
EPYETQLNQVTFWLNCLKALTLPEDNIAFGGKIRNPLRVVLVATHADIVNLPRSFGGEFS
YDKERSLLKEVRNRFGNDLLITEKLFVMDAGASNSKDIKLLRNLLFELRSTIISTCRPMT
QLAEKLLSTLPSWRKLNGPNQLISWQQFVVDVQEQINPLASEEDLRGLASQLHSMGEINI
MQSETVQDVVLLDPRWLCSNVLGKLLSIETPKAIHHYRGRYRVEELQHLVSEGDIDELLQ
VLDAMDVCARDLANPGMVDIPALIRTGGLQHTWTDEEDVEGEDALLYGGVRMVPVEHLAP
FPCGLFHKLQVNLCRWSRQQKPEVEADDVRLWSGGARIGLGGVEALVLLVNHGQGMEVQL
RGPDTDPGRCYALLDTLCGMAEGLLAATLPGLLTARHYLSPQQLREHHGPVMLYQPRDFF
RAQARGENALSNTMGGYRESFVSIVALGCIHVYKQGNLGGEVAVAEVSLLARRKLCRLLD
PPDALGKDWCLLAMNLGLSELAAKYSSGINGTPPADPLSLPSPTATLLQEWSQRPDSTIG
VLVAKLRELGRRDAADFLLRAAPVFRVNLEILGTPSEPYSPVCNGGGTSYNSISSVISR
NT seq 4320 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgttcaaccaggagaatgtggaggattattatgagattggaggagaactcggg
agtggtcagtttgccgtggtaaagaaatgccgtcataagagcactggtgtggagtatgca
gccaaatttatcaagaagaggcggagcaaatcaagccgacgaggggtctcaaaagacgac
attgagagggaggtcagcatcctgaaggaaatccagcaccccaatgtcatcaccctgcac
gatgtgttcgaaaacaagcatgaagtcatcctcatcctagagcttgtggctggcggagaa
ctctttgactttctagcagagaaagagtcactgagtgaagaggaggccaccgagttcctc
aagcagatcttggatggagtcagttacctgcactcgaaacggatttcccactttgacctg
aagccggagaacatcatgctgttaaaccggaacgtgcctcacccgcgcattaagctcatt
gactttggcctggcccacaagatcgattttggcaacgatttcaaaaacatctttggtacc
ccggagtttgtagctccagaagtggtgaactatgagcctcttggcctggaggcagacatg
tggagcattggagtaatcacttatattctgcttagcggtgcttcacctttcctgggtgaa
aacaagcaggagacgcttgccaatgtgtcagccgtggactatgagtttgatgaggactat
ttcagccacaccagcgctttggccaaagacttcattgcacggttactgatcaaagatcca
aaaaaaagaatgacaatcctggacagtcttcaacatccctggatcaagccaaaggataca
cagcaggcactgagtcgcaaagaatcagctgtcaatatggagaaattcaagaagtttgct
gcccgaagaaaatggaagcaatcagtgcgtctcatctctctgtgtaaccggctctcccgc
tcctttctgtccaggagcaacatgagtgtggcacgcagtgacgacacattggatgaagag
gactcgtttgtcatgaaggctatcatccacgcaataaacgacgacaatgttcccggtctg
aaacacctacttggatctctgaccagctatgatatcaatcaacctaacaagcatggaact
cctccgctcctgatcgctgcaggctgtggaaacgtccagatcattgatgtgctcatgaaa
aaaggggctgaaattcaagcctttgataagactggagccagtgctatctactacgccgcc
cgacatggtcatgtggggaccttgagattcttgcatgaaaagaagtgccctctggacatc
caagataagtccggagaaactgctctgcatgttgcggctcgctatggtaatgtggatgtg
gtccaatacctttgcagcatccatgccaaccctgacctgttggaccgggagcaagagacg
cctctccattgcgcggcctggcacggttattcggcagtggccagagccctgtgtgaggct
ggctgtgatgttaatgcccgtaaccgtgagggtgagagtccactgctaaccgcttcagcc
cgtggcttcaaggacattgtggagtgcttgctggagcatggggctgacatggactctgct
gataaggatggtcacatcgctctgcatctagccgtgaggaggtgccaggttgaggtggtc
aagtgtttgctcagccatcactgctatgtggaccaccaggatcgtcacggcaacacaccc
cttcacatcgcctgtaaagacgccaacatgcctgtggtcacgcagctctgtgctgccaaa
gccaacctggatattcccaacaaatttgggagaacacctcttcacctggcagcgagtaac
gggggtctggaggtggtgcggcatctctgtctttcaggagcaaacactgaggccatcact
aatgatggaaagacggcggaggatctggccactgcagagcagcaggagcatgtagcagtg
ctgctggccaagctgaaaaaggacaaccataagagcatttacatccagcagctgcggcct
acacagaccctccaacatcgcctcaaactcaagctgttcggccattctggagcagggaag
agcactctggtggagtccttgaagtgtggcatcttgaggagcttcttcagaaggaggagg
accaggctgaccaaccctgtccgacacccagcctcgccggtcacttccaaacctgcagtg
tctgtgagcatctctaacctgtatccggggtgtgagaatgtgagtgttcggagccgcagt
atgatgttcgagcccagtttgactaaaggagtgctggaggtcttcagtcctgttcataat
gctctctccacggctgacgacactgccactaaagccatcgacatccagaacgccaacgtc
aatggtgttggagacttcagtatatgggagttttctggcaatcccgtctattattgctcg
tatgactacttcgctgccaatgatgccacagcgattcatctggtcttattcagcctggag
gagccctacgaaactcagctcaaccaggtcacattctggctgaactgtctaaaggctctc
acgctgccagaggacaacatcgcctttggagggaagatcaggaatcctctgcgtgtggtt
ctggtggccacacatgctgacattgtgaatctgccccgatcgtttggaggagagttcagc
tatgacaaggagagatctctactgaaggaagtcagaaacaggtttggaaatgatctgctg
atcactgagaagctctttgtcatggatgcaggagcgtccaactctaaagacataaagctt
ctgagaaaccttctgtttgagctccgcagcaccatcatttctacctgcaggccgatgact
cagctggcagagaagctgttgtccactctgccttcctggaggaaactgaacgggccgaac
cagctcatatcatggcaacagtttgttgtggatgtgcaagaacaaatcaaccctctagcc
agcgaagaggatctgcggggactggcttcacaacttcacagcatgggagagattaacatc
atgcagagtgagacagtccaagatgttgtcctcttagatcctcgctggctctgtagtaac
gtacttggcaagcttctctcaattgaaacccccaaagcaatccaccattatcgcggccga
taccgtgtagaagagctccaacacctggtctccgaaggcgacatcgatgaacttctccaa
gtcctcgacgccatggacgtctgcgcccgcgacctggccaacccaggaatggtggacatc
cctgccctcattcgcacaggtggcctgcagcatacctggacagacgaggaggacgtggag
ggagaggacgctctgctttacggtggagtccgtatggttcctgtggagcacctggcaccc
tttccttgcggacttttccataagttacaggtgaacttgtgcaggtggagccgccagcag
aagcctgaggtggaggctgatgatgtgaggttgtggagcggtggcgctcgcatcggactt
ggtggtgtggaggctctggttctgcttgtgaaccacgggcaaggcatggaggtacagtta
cgaggacctgacacagatccgggacgctgctatgctttgttggacactctgtgcggcatg
gctgagggtctgttagctgctactttgcccggtttgcttaccgcccgacactatctcagc
cctcagcaactgcgtgaacaccacggcccagtcatgctttaccagccgagggactttttt
agagctcaagcgcgaggtgagaacgctctgtcgaacaccatgggtggctatcgcgaaagc
tttgtcagtatcgtagcattaggatgcattcatgtctacaaacagggcaacctcggtggc
gaagtggctgtagcagaggtcagtcttttggctcgacgtaagctctgccgcctgctagac
ccgcctgatgccctgggcaaggactggtgcctgttggccatgaacttgggccttagcgaa
ctagctgctaaatacagttctggcatcaacgggactccaccagcagacccgctttctctc
cctagccctacagccacactcctgcaggagtggagccagaggcctgactcaaccattggt
gttttggttgcaaagttgcgagaacttggccgtcgagacgcggcagatttcctgcttaga
gctgcaccagtgtttcgggtgaacttggagattttgggcaccccgtctgagccctacagc
cccgtgtgtaatggaggaggcacatcctacaactccatcagctccgtcatatctcgttag

DBGET integrated database retrieval system