KEGG   Danio rerio (zebrafish): 558359Help
Entry
558359            CDS       T01004                                 

Gene name
mllt4a
Definition
(RefSeq) afadin isoform X1
  KO
K05702  afadin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04520  Adherens junction
dre04530  Tight junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    558359 (mllt4a)
   04530 Tight junction
    558359 (mllt4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl DUF4477
Motif
Other DBs
NCBI-GeneID: 558359
NCBI-ProteinID: XP_021324351
ZFIN: ZDB-GENE-050419-52
Ensembl: ENSDARG00000029472
Vega: OTTDARG00000012561
Position
20
AA seq 1931 aa AA seqDB search
MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDRVAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKD
DREGRFVLKNENDIMPKRTLTNGPEKEKEGVIQNFKRTLSKKEKKKEKKREKEAFSRIPD
GDDHVLNREDGENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSEDG
RPDSGGTLRIYADSLKPNIPYKTILLSTTDMADFAVAEALEKYGLEKENPRDYCIAQVIH
ANDKAVKETILDDTDCPLQILRDWTSDKEALVFQLKKRPPDYAPRKGRKPDNRMGPQHGS
IPPEKLPYLVELSPGRGSHYAYYYRHHEDGSDSRDKPKLYRLQHSVTEVGSDRSEDGNIQ
LFGPGILPHHCDLMHADGLVTITPANMDAETFVDGQRIADTTVLRSGVTVQFGATHVFKF
VDPSYDQSMSKRDPGPMMKGRHKSGSVPETTFDLHGDIHSGSALPTSKSSGKLEMERSGN
SSERGLVKPMIRGEQQDFSKHDGRSQDGPELTLPASIEFRENSEDAFLSAIINYTNSSTV
HFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQEIAEGDQKQ
KNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNY
MPAFLEDPDEQNPQRPKIEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFVNMWLFNK
LVTEADSGLCSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSMQ
DVQNINNTCFKLNSLQLNALLSNYHCAPDEPYIPPELIDHVVAVAENTADELARSDGREV
QLEEDPDLQLPFLLPEDGYSCDVVRNIPNGFQEFLEPLCQRGFCRLTPHPRSPGTWTIYF
EGANCDSHFSADTSELPMRKEPEIVTVTLKKHNGMGLSIVAAKGAGQDKLGIYIKSVVKG
GAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGLATLL
NQPSPMMPRASDRGRGDKGKLRPKSEGFELYNNSVQNGSPESPQGTWDTYPEPKKEDRLL
KNRADHRSSPNVANQAQSPGGKPVYPGAPGKITSVSTGNLCPDEEPSPPRPEAYPIPTQT
YPREYFTFPASKSQDRMGPGQPWQNNEQEPLPPMDNHSNNSMVMQRVARSQEELCDMPGG
YPGERLRQEDLMLLQQQQQREAEYQRGVGEHWNHQVSSSVESSTSSQEHLNFSSSSGSRT
QGNHKSGPGRWKTPLAPHSGPVSQPSRSDLPPPPPPPPAHYDFEPQTDLPLPPPPSATQQ
QQQAAADRKKREDQQRWYEKEKARLEEERERKRRDQERKLVQIRNPSVSGPVMHNNQHGP
VPPSPQMPPMTLPQSYLPPVQQPPPPQPARPDKLSSLPRQPPQDTVIRDLLPQQQPRTIE
RRDLQYITISKEELSASDSLSPDPWKRDAREKLEKQQQLHIVDLLDKEIQELQAKPERTA
EDNDRLRKLMLEWQFQKRLQESKQNEEDEEEEDDEDVDTTLIMQRLEAEKRARQTAVPAI
SVLDLLQDEERRRKQQLEEIRKREAEERAKQEEERRWREEERARREADEKRRQEEEYYTR
LEAERRRQHEEAERKLPTPDETGLYRPPLPRDYQPPSPSSAPATNHTTSAPPPPPQRNTS
YLKTQVASPDTIYTAKFVSYNDEEEEEDEEDAGLTGQVKLSATRKSYGDLPPAPKPQPPP
TARKPRPVSDGIFLSNSFQLPAGLNANSTALKTGQPPLPFTKPSFIPSANSKGFNSYTGN
TTGLVSGEVYKDPRDKWTKGSPDQENTIGGAPENLTFKERQRLFSQGKEVSNKVKASRKL
MELENELNIKQ
NT seq 5796 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggagccgagaggaggagcggcggaaactcgccgacatcatcaaccactggaac
gcaaaccggctcgacctgttcgagatcagccaacccacagaggatttggagttccatggg
gtgatgcggttttacttccaggaccgtgtggcagggaattttgccacaaagtgcatcaga
gtgtccagtacagccaccacacaagatgtgatcgagacgctggcggagaagttcagaccc
gacatgaggatgctgtcttctccaaaatactccctctatgaggtccacgtcagtggcgaa
gagaggaaactggacttggatgagaaaccactggtcgtgcagctgaactggaataaagac
gacagagagggccgcttcgttctcaagaacgagaatgacattatgcccaagagaacactg
acaaacggtcctgaaaaggagaaagagggggtgatccagaacttcaaaagaacactgtcc
aagaaggagaagaagaaagagaagaagagggagaaggaggctttttccagaatcccagat
ggagacgatcatgtgttgaaccgcgaggatggagagaactccagattagcagctgaggtt
tataaagacatgccggagaccagtttcacaaggaccatttctaaccccgaggtggtgatg
aagagaagacgacagcagaagctggagaagaggatgcaggagtttcggagtgaagacggt
cgacccgactcaggaggcactctgaggatctacgctgatagtctgaagcccaacattccc
tacaagaccatcctgctctcaactactgacatggctgactttgctgtggccgaggctctg
gagaaatatggcctggagaaggaaaaccctagagactactgcatcgcccaggtgattcat
gcaaatgataaagcagtgaaggagaccatattagatgacacagactgtcctctgcagatc
ctcagagactggacgagtgataaagaggccttagttttccagctgaagaagcgtcctcca
gattacgctccaaggaaaggacgtaagccagacaaccggatggggccgcagcacggatcc
attcctcctgagaaactgccttacctggtggagctgagcccagggcgagggagtcactat
gcctactactaccgccatcatgaagatggctccgactccagggacaaacccaaactctac
agactacagcacagcgttactgaggtcggatctgaccggagtgaagatggaaacatccag
ctgtttgggcctgggattctccctcatcactgtgaccttatgcatgcggacggcttggtg
accataaccccagccaatatggacgcagagacatttgtggatggacagcggatcgctgac
actacagttctgcgcagtggggtgaccgtccagttcggagcaactcacgtcttcaaattc
gtagaccccagttatgaccagagcatgtccaaaagagaccccgggcccatgatgaaaggc
aggcacaaatcagggagtgtcccagagacgacctttgacctccacggggacattcacagt
ggctctgctctccctacaagcaagagctcagggaagctggagatggagcggtcaggaaac
agcagtgaaagaggcctggtgaagcccatgattcgtggagagcagcaggactttagcaag
catgatggaaggtctcaggacggcccggagctcactctgcccgccagcatcgagttcagg
gaaaactccgaggatgccttcctgtcggccatcatcaactacaccaacagctcgacagtg
cacttcaagctttctcccacatacgtgctgtacatgacctgccgttatgtcatgtccagc
caataccggcccgacatcagtccctccgaacgcacacacaaagtcatcgccattgtcaac
aagatggtgagcatgatggaaggagtcatccaggagattgctgaaggtgatcagaaacag
aagaacatcgctggagctctggcgttttggatggcgaacgcttctgagctgctgaacttc
atcaaacaggacaaggatctgagtcgcatcacgctggatgctcaggatgtgctcgctcat
cttgttcagatggccttcaagtacctggtgcactgtctgcagtcagatctcaataactac
atgccagctttcctggaagatcccgacgagcaaaacccacagaggcctaagatagaggat
gttctgcacacgctgacgggtgccatgtctctgctgcgccgatgccgtgtgaacgcggcg
ctcaccatccaactgttttcgcagctcttccacttcgtcaacatgtggctctttaacaag
ctggtgacggaggccgattctggcctgtgctcacactactggggcgccatccttcgccag
cagctcagtcatattgaggcctgggctgagaaacaaggcttggagctggctgcagactgc
cacctcagccgcatagtccaggcgacgaccctccttactatggacaagtactccatgcaa
gatgtccagaacatcaacaacacctgcttcaagctcaactctcttcagctcaacgctctg
ctgagcaactaccactgcgctcctgacgaaccctacattcctcctgagctgattgatcac
gtggtggccgtggccgaaaacactgcagacgaactggcccgaagcgacgggcgggaggtt
cagctggaagaggaccccgaccttcagctgcctttcttgctgcctgaggacggctactcg
tgcgatgtggtgcgcaacattcccaacggattccaagagtttctagagccactttgccag
agaggtttctgtagattgactcctcatccacgctcgccgggaacttggaccatttatttt
gaaggagccaactgtgacagtcacttctcagccgacacctcagaactgccaatgcggaag
gaaccggaaattgtgaccgtgactttgaagaaacataatggaatgggcctcagtattgtg
gcggccaagggtgccgggcaggacaaacttggtatttacatcaaatctgttgtcaaagga
ggtgcagcagacatggatgggcgtctggctgctggagaccagttgcttagcgtggatgga
cgtagtcttgtcggcctctcgcaggagagagcggcagaattgatgacacgaactgggtct
gttgtaacgcttgaggtggccaaacaaggagccatttatcacggtctggccacacttctt
aaccagccatcccccatgatgcctcgcgcgtcagaccgtggacgtggcgacaaaggaaag
ctgagaccaaagagtgagggctttgagctctacaacaactctgtacagaacggctcacct
gagagcccacagggcacgtgggacacctatcctgaaccaaagaaagaggacaggttgttg
aagaaccgagcagaccatcgatccagcccaaatgtggccaatcaggctcagagtccaggc
gggaagcctgtttatccgggagctccaggaaagatcacttcggtctcgacgggtaacctc
tgccctgatgaggagccctctccaccccgtccagaggcctatcccatccccactcagact
taccctagggaatacttcaccttcccagcctccaaatctcaggacaggatgggccctggc
cagccctggcaaaacaacgaacaagagcctcttccccctatggataaccactccaacaac
agcatggttatgcagcgggtggcgcgatctcaggaggagctgtgtgacatgccgggcggg
tacccaggtgaacgtctgcgccaggaagatctaatgctcctccagcagcagcagcagcgt
gaagctgagtaccagcgaggtgttggagaacactggaaccaccaggtgtcttcctcagtg
gagtccagcacctccagccaagagcacctcaacttctcctcatcctctggctccaggacc
cagggcaaccacaagagtggcccaggccgctggaagaccccacttgcacctcattccggc
cctgtctcccaaccctcccgttcagaccttcctccacctccacctcctccaccagcacac
tacgattttgagccgcaaaccgacctgccgcttccaccgccaccttcagctacacaacaa
cagcagcaggctgcagccgaccgcaagaaacgtgaagaccaacagcgctggtatgagaag
gaaaaagctcgtcttgaagaggagcgagagaggaagagacgagatcaggaaaggaaattg
gtgcaaatccgaaacccttcggtttctggtccagttatgcacaataaccagcatggcccg
gtgccaccatctccacaaatgcctcccatgacacttccccaatcataccttcctccagtc
caacaacctccgccaccacaaccggctcgacccgataaactctccagtcttcctcgccag
cctccgcaagacaccgtaatccgggacctcctgccgcagcagcagccgcgcaccatcgag
agacgcgacctgcagtacatcaccatcagcaaggaggagttatcggccagcgacagcctg
tcacccgacccctggaagagggacgcccgggaaaaactggagaagcagcagcagcttcac
atcgttgacctgctggacaaggagatccaggagctgcaggctaaacccgagcgcacggcc
gaggacaacgaccgcctgcgcaaactcatgctggagtggcagttccagaagagactgcag
gagtccaagcagaacgaggaggacgaggaggaggaagacgatgaagacgtggacaccacg
ctcatcatgcagagactggaggccgagaagagagcacggcagactgctgttccagcaatc
tctgtactagacttgctgcaggacgaggagcgacgacggaagcagcagctggaggaaatc
cgcaagcgcgaagcagaagagcgagccaaacaggaggaggagagacgctggagagaggag
gagagagccaggagagaggctgacgagaagaggagacaggaggaagagtactacacccgc
ctggaggcagagcggcgccggcagcacgaggaagctgagcgcaagctgccgacgccagat
gagacgggtctgtacagaccccctttaccccgggactaccagcccccttctccctcaagc
gcacccgccactaaccacaccaccagcgcccccccgcctccgcctcagagaaacacctcc
tacctcaaaacccaggtcgcctccccagacaccatttacactgccaagtttgtctcgtac
aatgacgaggaggaggaggaggatgaggaagatgcgggcctaacaggtcaggttaagctc
tcggccacccgcaagtcctacggcgaccttccgcctgccccaaagccccagccgccgcca
accgcgcgcaagccccgtcccgtctcagatggcatctttctgtccaactcattccagctg
cccgctgggctcaatgccaacagtactgctctcaagacagggcagccccctctccccttc
accaaacccagcttcatcccatcagccaactccaaaggatttaattcatacactggaaac
acaacaggactagtatcaggagaggtgtataaagacccgcgagacaagtggaccaaaggc
agcccggatcaagagaacacaataggaggagctccagaaaacctgaccttcaaggagcgc
cagagactcttctcgcaggggaaagaggtctccaataaagtcaaagcgtcccgaaagctg
atggagctggagaacgaactcaacataaaacagtag

DBGET integrated database retrieval system