KEGG   Danio rerio (zebrafish): 558496
Entry
558496            CDS       T01004                                 

Gene name
cerk
Definition
(RefSeq) ceramide kinase
  KO
K04715  ceramide kinase [EC:2.7.1.138]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    558496 (cerk)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.138  ceramide kinase
     558496 (cerk)
SSDB
Motif
Pfam: CERK_C DAGK_cat YegS_C
Other DBs
NCBI-GeneID: 558496
NCBI-ProteinID: NP_001099056
ZFIN: ZDB-GENE-041210-210
Ensembl: ENSDARG00000069169
Vega: OTTDARG00000008502
UniProt: A5WVZ0
Position
4
AA seq 649 aa
MEKQSTLLCSELSVQRRLYEVTLNCAILAWKDVQNAKKHTGRAIYGAVKAGSHCVPVCEI
IAVQEKEDDSPCKDTGKWQKVPQSPTDSCQHAFTVYYVERTRQHCWRCSNVTFQYSEHSL
CLLWIQTIKEQLALLSAQSTEELAGVHQPLRRKTTRQADLRPQSGPHLFPGFHFHRRDWP
HSFSAHPSELRFYIIADGKEPVMKCTGDCFSPRVQLHHLMQLIDGLHQASRKMQFNCQMN
IMMFLPPLYHQPGNNGFSLFVSIVTEHANHARDHLKAEADLKKYDGVVCVGGDGMFSEIM
HGLVSRTQQDAGVDENSTEETLIPCGLRIGIIPAGSTDCICYATVGSNDPVTSALHMVVG
DSQPMDVCSVHSDDRFLRYSVSLLGYGFYGDVLKDSERKRWMGPARYNISGVKTFLSHRY
YEGTVSFLPAEENLGTPRDKVQCRSGCSICRRSSSDKLLSKEDEASVSDVDCRDTWTVIR
GKFLAINAANMSCACPRSPKGLSPSAHLADGTTDLILVRKCSRVDFLRHLLRHTNKKDQF
DHSFVEVYRVKQFRFTPRFQECGSEMDLRESRAGGKHFFCQICRENRACGCMSSQSNWNC
DGEILPHTAIQVRVHCQLIKLFARGIEEQPVFEDLYAHCQLNNPPNHEP
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggagaagcagtcgacattgttgtgttctgagctgagtgttcagcgcagactgtatgag
gtcacattaaactgcgcgattctcgcgtggaaagacgtacaaaacgccaaaaaacacacc
ggacgcgccatatatggagctgtcaaagctggtagtcattgtgtcccagtgtgtgagatt
atagctgttcaggaaaaggaagatgactccccatgtaaagacactgggaaatggcagaaa
gttccccagagcccgacagactcctgccagcacgctttcacagtgtactatgtggagagg
acgagacagcactgctggcggtgcagcaacgtgactttccaatactccgaacattcccta
tgcctgctctggatacaaacgattaaggaacagctagcattattgagtgcccaatcgacc
gaagagcttgctggtgtacatcaacccctacggaggaaaacaacgcggcaagcagattta
cgaccacaaagtggcccccatcttttcccgggcttccatttccaccgacgtgattggccc
cattcattttcagcgcatccctccgagttacgcttttacatcatcgctgatggtaaagaa
ccggtaatgaaatgtaccggggattgtttttcaccacgagttcagcttcatcatctgatg
cagctgattgatggtctccatcaagctagcagaaaaatgcaatttaactgccagatgaac
ataatgatgtttctcccccctctctatcatcaacctggtaacaatggcttttcccttttt
gtttctatagttacagagcatgcaaatcatgccagagaccacttgaaggcagaggctgat
ctgaagaagtatgatggtgtggtgtgtgttggaggagatggcatgttcagcgagattatg
catggccttgtctcccgaacgcaacaagacgccggtgtagacgagaactcaacagaagag
actcttattccgtgtggacttcgcatcggcattattcctgcaggttccactgactgtata
tgctatgccacggttggctcaaatgaccccgtcacctcagcgctgcacatggtcgtgggt
gattctcaaccaatggatgtctgctcagtgcacagcgatgatcgtttcctgcgttactct
gtctcactgttgggttatggtttctatggagatgtgctaaaagacagcgagaggaagaga
tggatgggtcctgctcgttacaatatctcaggggttaaaacgtttctgtcacatcgctac
tatgagggaaccgtgtctttcctacctgcagaagagaacttgggaactccaagagacaaa
gtgcagtgtcgatctgggtgcagcatctgccgtcgatcctcatccgacaaactcctcagc
aaagaagacgaagccagcgtttctgatgtcgattgccgggacacctggacggtcatcagg
gggaagttcttggccattaatgccgccaacatgagctgtgcatgtcctcgcagtcctaaa
ggtctgtcgccgtccgcacacctagcagatggaacgactgacctcatcctcgtcagaaag
tgctccagagtcgacttcctgcgacacctgctgcgacacaccaataagaaggaccagttc
gatcactcatttgtggaggtgtaccgagtcaagcaattccgcttcactcccaggtttcag
gagtgtggctcagaaatggacctgagagagagcagggcgggaggcaaacacttcttctgt
cagatctgcagggaaaacagagcctgtggctgcatgtcgtcccagagcaactggaactgt
gacggagagatccttccacacactgccattcaagtccgagtccactgccagttgatcaag
ctgtttgcgagaggaatcgaagagcagccggtgtttgaggatctgtacgctcactgtcaa
ctcaacaatcctccaaatcatgagccgtga

DBGET integrated database retrieval system