KEGG   Danio rerio (zebrafish): 558662Help
Entry
558662            CDS       T01004                                 

Gene name
xpo5
Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    558662 (xpo5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dre03016]
    558662 (xpo5)
   03036 Chromosome and associated proteins [BR:dre03036]
    558662 (xpo5)
Transfer RNA biogenesis [BR:dre03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    558662 (xpo5)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     558662 (xpo5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N Vac14_Fab1_bd
Motif
Other DBs
NCBI-GeneID: 558662
NCBI-ProteinID: XP_017214411
Position
13
AA seq 1216 aa AA seqDB search
MGEQMRALCEELIKAVNVMMEAESSQTYRLEAFKFIEDFKEKSPFCVECGLQLAEKSQTA
VIRHFGLQILEHVVKFRWNNMAPQDKLQLKNCTMGMLSNGTHPILQEECHVKDALSRIVV
EMIKREWPQQWPDMLKEMEALTALGDAQTELVMLVLLRLAEDVITFQTLPSQRRRDIQQT
LTQNMDSVFTFLLGILQLHVNEYSKMKCVAGLDLKMKAHLRVGVATLNTLAGYIDWVSLS
HITSQNCRLLEILCLLLSEPELQLEAAECLLIAISRKGKLEERKPFMVLFDEAAMNYILS
AAQSADGAALCNQSSGGIDERRYTFLKRLCQVLCALGSQVCSLVGSDVEVQVPVNLNKYL
EALLAFTTHPSQFLRSSTQMTWGIIFRHEILSKDPVVGQMAIKYLRATRINLVKTGFPSK
NDCPGCEFSRVDFDSDEDFNSSFNSSRAQQGEAVRLTCRIVPFKAFQIARDWMQYQISTP
IDAGKTTAKTEKGLCSPLSPSVVQWEAMTTFTENVFGQLFKILEKEKLPIDEGMALLQIA
VNFETRDPLILSCVLTIVSTLFPILTHRPHFLPQVLFKIFSAITFELVDERKAPRTRAVK
NVRRHACSSIIRICRDYSDFMLPCFDLMYEHVKRLFSDELLLTQLEKCALMEALILISNQ
FKDYKKQKAFLEELMAPVTALWLSEEMRSVLWDPATFLTFVGADQEISDSDTDEQMGINR
SRISLCVHTILGVVKRARWPADADQAKAGGFVVRTASDGTPVYRNPCAEALQALLPNLLA
LIRTNNSLFLPENITRLSKTFARVYDITDMEKNCVLGISQVVLDSYEAAVYKNFAERMQG
FFSSLFENCYHVLGNVGPCLQQDFYGIEGLAEQIVGSAFNHLDSVPDHRLRPLIRLFMKQ
LVISCPHEYYDRLLCPLLGPLFSYLLQRLNFRWQIINQRASLSAQEEEEAYEENHVTQEM
VEEQLLRLVTREVMDLLSVTCITRKCPEVNANKEEADGDEEMVSMDSSQGNQVNTPSDEL
SDLGKCLLQSEDIYMTVLTICFNCLSWKDTVNCQRTAGVLCWTLLKQVQGGNLLPEAVTW
LFASVLKGLQMHGQHEGCNVALTQLALLIYESLRPRYAELRLIMNQIPDVQADALEQFDQ
KIQPGASKLGEKKKKEQFRRLIAGTVGKPLAQQFKKEVHIRNLPSLFKKPKPTKDLLENN
EDATLISLFTPDHDRC
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaacagatgcgtgcgctgtgcgaggagcttataaaagctgtgaatgtgatgatg
gaggcagaatccagccaaacataccgactggaggcctttaagtttattgaagatttcaag
gagaaaagtcccttctgcgttgaatgtggtcttcagctagcagagaagtcccagactgca
gtgataagacactttggactgcaaatactggagcatgtggtcaagtttcgctggaataac
atggcaccgcaagacaagctccagctgaagaactgcaccatgggcatgttgtcaaatggt
acacatccgattctccaagaggaatgtcatgttaaggacgccctctcccgcatcgtggtg
gagatgatcaagagagagtggccgcagcagtggcccgatatgctgaaggagatggaggcc
ctcaccgctctcggggatgctcagaccgagcttgtaatgctggttctgctgcggttggcc
gaggatgtgatcacgtttcagacgttgccctctcagagacggcgggacatccagcagacg
ctcacacagaatatggacagcgtcttcactttcctgctggggatactgcagcttcacgtc
aacgagtacagcaagatgaaatgtgttgctggtctggatttaaagatgaaagctcacttg
cgtgttggtgtggctactctcaacactctagcaggctacattgactgggtttctctgagc
cacatcaccagtcaaaactgccgtcttctggagatcttgtgcctgttgttgagtgaacct
gagctgcagctggaggccgcagagtgtctgctaattgcgattagtaggaaaggcaagtta
gaggagaggaaaccatttatggtgctctttgatgaagctgcaatgaactacatcttgtct
gcagcacagtcagcagatggtgcagctctgtgcaaccaatcctcaggtggcatcgatgaa
aggagatacacttttctgaagaggctctgtcaggttctctgtgctctgggcagtcaagtc
tgctctctagtgggttcagatgtggaagtgcaagttcctgttaacttgaataaatatttg
gaagctcttctagcgttcactactcatcccagccagtttctgaggtcgtcaacgcagatg
acctggggaatcatattccgacatgaaatactgtcaaaggatccagtagttggccaaatg
gccatcaaatatttaagagcgacgaggatcaatcttgtaaaaactggatttccctccaag
aatgattgtccaggctgtgaattctccagagtggactttgacagcgatgaagatttcaac
tcctcctttaattcttccagggctcagcagggggaagcggttcgcctcacttgtagaatc
gtcccttttaaagcctttcaaattgcaagggactggatgcagtatcagatcagcacacct
atagatgctggaaaaacaacagccaagacagagaagggtctctgctctcctctgtcccct
tcggtggttcagtgggaagccatgaccaccttcactgaaaatgtgtttgggcagctcttc
aaaatcctcgaaaaagagaaactccccatagacgagggcatggcgctgctgcagatagcg
gtgaatttcgagaccagagatcctctcattctgtcctgtgtgctcaccatcgtctccaca
ctcttccccattctcacacaccggcctcacttcctacctcaagtactctttaagatattt
tctgcaatcacgtttgagttggttgatgaacgcaaggctcctcgaacgcgagcggtgaag
aacgtcagaagacacgcctgctcctccatcatcaggatctgtcgcgattattcagacttc
atgctgccgtgcttcgacctgatgtatgagcacgtgaagaggctgttctccgatgagctg
ctgctgactcagctggagaaatgtgccctcatggaggccctgatactgatcagcaatcag
tttaaagactataagaagcagaaagccttcctggaagagctgatggccccggtcactgca
ctgtggctatcggaggagatgaggagcgtgttgtgggaccctgctacttttttgacgttt
gttggtgctgatcaggagatcagtgattctgacactgacgaacagatgggcatcaacagg
tcacggattagtctttgtgtgcacaccattctcggtgtggtgaagcgagctcgctggcct
gctgatgctgaccaggccaaagctggaggttttgtggtgcgcactgcctctgatgggacc
ccagtctacagaaacccctgtgcagaggccctgcaggccctgctgcccaaccttctggca
ctcatcaggaccaacaacagcttgttcttgccggagaacatcacccggctcagcaagacc
tttgctagagtctatgacattacggacatggagaagaattgtgttttaggaatctctcag
gtagtgttagactcctatgaggcggcggtgtacaaaaactttgctgagcgcatgcaaggc
ttcttctcctcactcttcgaaaactgttaccatgttctgggtaatgtgggtccctgcttg
cagcaagacttttatggtatcgagggtttggcagagcagattgttggatccgccttcaac
catctagacagcgttccagaccacaggctccgccccctaatccgtctcttcatgaagcag
ctggtcatctcctgtcctcatgagtactatgacagactcctctgtcctttgctgggtcca
ttattttcctacctactgcagagactgaactttcggtggcagatcatcaaccaacgggcc
agtctgagtgctcaggaagaagaggaggcctatgaggagaaccatgtgacccaggagatg
gtggaggagcagctgctgcggctggtcacgcgagaggtcatggaccttctgagtgtgact
tgcattacaaggaaatgtccagaggtaaatgcaaacaaagaggaagcagatggagatgag
gagatggtgtcgatggactcctcacaggggaatcaggtcaacacaccttcagacgagctc
tcagatctgggcaagtgccttctccaaagcgaggatatttacatgactgtcctgactata
tgttttaactgtctgtcctggaaagacactgtaaactgtcaacgcactgctggtgtgctc
tgctggacgctgctgaaacaggttcagggtgggaatctgctcccggaggccgtgacgtgg
ctcttcgccagcgtcctgaagggtctgcagatgcacggacaacatgaaggctgtaatgtg
gcgctcactcaactggccttgctcatctacgagtctctaagacctcgatacgcagagctg
cgcttgatcatgaatcagatccctgatgtccaggctgacgcgctggagcagtttgaccag
aagatccagcccggagcgtcaaagctgggagagaagaagaagaaagagcagtttaggaga
ctcatcgcaggaactgtcgggaaacccctcgcacagcagttcaagaaggaagtgcacatc
cgaaaccttccgtctctgttcaagaagcccaaacccacgaaagacttgctggagaacaac
gaggacgctactctgatctctctgttcactccagaccatgacagatgttga

DBGET integrated database retrieval system