KEGG   Danio rerio (zebrafish): 558801
Entry
558801            CDS       T01004                                 

Gene name
fezf1
Definition
(RefSeq) fez family zinc finger protein 1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zinc_ribbon_15 Zn-ribbon_8 zf-Sec23_Sec24 zf-Di19 zinc_ribbon_9 SRI
Other DBs
NCBI-GeneID: 558801
NCBI-ProteinID: NP_001107820
ZFIN: ZDB-GENE-060929-970
Ensembl: ENSDARG00000010270
Vega: OTTDARG00000028426
UniProt: Q25C93
Position
25
AA seq 429 aa
MDSALYHSAGIFGAPSASTGGSMIASSKPLAFSIERIMARTPEPKSIPFPNLFQAPVGKA
EPKQSPAPLHCMIPLMPLACEPPHKLHINGLDHPDTFAYNANELLSIGLNYKNEQQDAAP
AIGQYKLFRPRVVNQSSFHAMGAAVCYLNCGEGACPPHAGLVNLHPMASYLLNTPLHARQ
KSLFSSEKSKQGAVADRCPPGVSFKELSHSHLHHYMKESAHILSEKLFKNSAAKVNSGSP
QTKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQE
KPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFICEFCGKGFHQKGNYKNHKLTHSGEKQFK
CNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHIRKLHDISPGPHSPP
TPTGNTEGQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggacagcgcgctgtaccactcagcgggaatattcggcgccccttcggcttcgactgga
ggaagcatgatcgcgagctccaagcctctcgcgttttcgatcgaaaggattatggccagg
acgcccgaaccaaagtcgataccgttcccgaacttattccaagctcccgtggggaaagcg
gagcccaagcagtctcccgccccgttgcactgcatgatccccctcatgccactcgcctgc
gagccgcctcataaacttcacatcaatggattagaccaccctgatacttttgcgtacaac
gcgaacgagctgttgagcatcggactgaactacaagaacgagcagcaagatgcggctccg
gccatcggacagtacaaactattccggccgcgcgtggtcaaccagtcgtcgttccacgcc
atgggagccgccgtctgttacctgaactgcggggaaggtgcgtgtccgcctcacgcgggt
ctggtgaacctgcaccccatggcatcctatctcctcaacacgccgctccacgcgcgccag
aagagcctgttctcctcggagaaaagcaaacagggggccgttgcggacaggtgtcctcct
ggcgtttcttttaaggagctttctcactctcatctgcaccattacatgaaggagagcgcg
cacatcttgtcggagaagttgttcaagaactcggcggctaaagtaaacagcggctctcct
caaaccaaaccaaaggtgttcacctgtgaagtttgtggcaaggtgttcaacgcgcactat
aatttaacgcgtcacatgccggttcacacgggcgccagaccgttcgtctgcaaagtatgc
ggcaaaggattcagacaagcgagcaccctgtgtcgccataaaattatccacactcaggaa
aagccgcataaatgcaaccaatgcggcaaagcttttaaccgaagttcaactctcaacact
cacacccgaattcacgcaggatacaaacccttcatttgtgaattctgcggcaaaggattt
catcagaaaggaaactacaagaaccacaaattgacccacagcggagaaaaacagttcaag
tgcaatatctgcaacaaagccttccaccaggtgtacaaccttacatttcacatgcacacg
cacaacgacaagaagcctttcacatgcccgacatgcggcaaaggtttctgcaggaacttt
gatcttaaaaaacatattaggaaactgcacgacatttcccctggaccccactcaccaccg
acacccactggaaacacggagggtcagtga

DBGET integrated database retrieval system