KEGG   Danio rerio (zebrafish): 559024Help
Entry
559024            CDS       T01004                                 

Gene name
ncanb
Definition
(RefSeq) neurocan core protein
  KO
K06794  neurocan core protein
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:dre00535]
    559024 (ncanb)
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    559024 (ncanb)
   04091 Lectins [BR:dre04091]
    559024 (ncanb)
Proteoglycans [BR:dre00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   559024 (ncanb)
Glycosaminoglycan binding proteins [BR:dre00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   559024 (ncanb)
Lectins [BR:dre04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   559024 (ncanb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink Lectin_C EGF V-set Sushi hEGF EGF_CA Ig_3 EGF_2 Chordopox_A33R I-set
Motif
Other DBs
NCBI-GeneID: 559024
NCBI-ProteinID: XP_017208935
ZFIN: ZDB-GENE-050208-586
Ensembl: ENSDARG00000005783
UniProt: F1QEZ8
Position
22
AA seq 1254 aa AA seqDB search
MLGELRLTALQSLLAVCLLFTLEHSLVRGDTVVNMRKVTHQQVQEPLSGSALLPCVFTLS
PSPSHEPPRIKWTKLWGQRGPDGLQKQQSILVAKDNIIKVKKAFQGRVTLPGYPGNRYNA
SLVLTGLRSSDSGMYRCEVVVGINDEQDTVPLQVTGVVFHYRAPHNRYALSFSDAKRVCV
ENSANIATPAQLQATFDDGYDNCDAGWLSDHTVRYPIQSPRPGCFGDREDSPGVRNYGTR
APDEMFDVYCFANSLQGEVFHTSVPEKLSLASASTHCHTLGAQLATVGQIYLAWQAGLDR
CDPGWLADGSVRYPINLPRRNCGGDEPGVRTVYHNPNRTGFPDTTDLFDAYCFQEKNFKE
QAPILQKTLENSNLNSSSNEEEQLQRTGAFPEPSTWTGLVDLEKEDFKSIINHESSEISE
EHVVIHLGPEERSVDWDEDPKEKQENLQGGSAKEETDDPEGPEVSSDPSSTTPSSSTQAQ
TSNSVISTIVNTIMKPFRYWAGTGEPEIPATESSVYRGTPEMVPSARTKPSKGKASKGGY
DNAIVEPNTKEYSYRPSSSDPEEELLEQEREVVLVHAQQEMKSSSNSHMDLPYSETFTDS
FSGPPQGAIESGTADPTAKTFSQMRSSQNIWALKSSKGAPNNNRLFIAQTSSPMEAKRGE
LEIMTIPVSTNNPENFSGEGKDLNEDGYPIPKSPLSAENEKDAEGSGGKDLPFTLNAQMK
GSDDPGVPQETTVKWQLMSLQTTQPSGASSPSETKHVEPTSTVKEARGEIMYVHRPVEKR
KNSPSNKVNVPFVQRKQELTPEVQTFNTPTTPSPVHAIEDKLTISPTPSQPVEETTTEDI
LCTPDPSVSSTWLPVVQEEVDTPQPSVSSTTITQAGLAAQPTPPDPKDASQQAESRSGGS
ESFVLARGWTTPKTVSAEEPSFQTTGNPERDSTNAAVTVLENSTSKTSEDDPCQTNPCLH
GGSCLIEGGGYSCLCPQGYSGESCEIDIDDCQSNPCQNGGTCIDEINSFVCLCLPSYGGA
TCEKDTEGCEHNWRKFHGHCYRYFTRRHTWEDAEKDCREHNGHLASIHSAQEQDFINGMS
HENTWIGLNDRMVEDDFQWTDNMDLQYENWRENQPDNFFAGGEDCVVMIAHENGKWNDVP
CNYNLPYICKKGTVLCGTPPTVDNAFLIGRKRSHYDIHSVVRYQCGDGFLQRHVPTVKCR
ANGKWDRPKIICTKSRRSHRYRRHHHKSHHERRKHKRHGSGGGHRGQQEGHGHF
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atgctgggggagctccgcttgactgcgctccagtctctcctggctgtgtgtctgctcttc
accctggaacacagcctggtgaggggtgacactgtggtgaacatgcgtaaagtgactcac
cagcaggtccaggagcctctatcgggttcagccctcttgccgtgtgttttcactctgagc
ccgagtccctcacatgaacctcctcgcatcaagtggaccaaactgtggggtcagcgtggc
ccagatggcctccagaagcagcagtctatcctagtggccaaagacaacatcatcaaggtg
aagaaagccttccagggtcgcgttaccttgccgggatacccaggaaaccgctacaacgcc
agcttggtgctgacaggcctgcggtccagcgattcagggatgtaccgctgcgaggtcgtg
gttggcattaatgatgaacaagatacggtgccccttcaggtcacaggagtggtgtttcat
tatcgtgctcctcacaaccgttacgcactttccttctccgacgctaaaagagtgtgtgtg
gaaaactcagccaacatcgccacaccggcgcagcttcaggccacgtttgatgacggatac
gacaactgtgatgccggctggctttctgaccacaccgtcaggtatcccatccagtcccct
cggccgggctgtttcggtgacagggaggattcgcctggcgtgaggaactacggcacacga
gcccccgatgagatgttcgatgtgtactgctttgccaacagtctgcaaggtgaagtgttc
catacaagtgtgccagagaagttgagcttggcatctgcctccactcactgccacactctg
ggagctcagctggccacagtcgggcagatctaccttgcctggcaggctggcctagaccgc
tgtgaccccggctggctggccgatggcagtgtgcgctaccccatcaacctgccccggcgt
aactgcggaggggatgaaccaggagtacgaactgtttaccacaaccccaaccgcaccggc
ttcccagacactactgatctctttgatgcttactgctttcaagagaaaaatttcaaagag
caggcgccaatacttcagaagacccttgaaaactccaatttgaactcttcaagcaacgag
gaggagcagctacaaagaaccggagccttccccgaaccttcaacctggaccggtctggtt
gaccttgagaaagaagatttcaaatccatcataaaccacgaatcttctgaaatttcagag
gagcatgttgtaatccatctgggacctgaggaaaggtctgtagactgggatgaagatcct
aaagagaagcaggagaaccttcaagggggttcagcgaaagaggagacggatgatccagag
ggtcctgaagtatcttctgacccatcctcaaccacaccatcatcctctacacaagctcag
accagcaacagtgtcatttctaccattgtgaacacaatcatgaaaccatttagatactgg
gctgggactggagagcctgaaataccagccacagagtccagcgtctacagaggaacccca
gaaatggtcccgtctgccaggacgaagccaagtaaagggaaagcaagcaaaggaggttat
gataatgccatagtggagccaaatactaaggaatattcctaccgtccttcatcttcagac
ccagaagaagagctcttggagcaggagagagaggtggtgctggtgcatgcacagcaagag
atgaagagttcaagcaactctcacatggatcttccatattcagagaccttcacagacagc
ttcagtggaccaccccaaggagcaattgaatcaggaacagcggatccaactgctaagact
ttcagtcagatgaggagcagccaaaatatttgggcgcttaagtcctcaaagggtgctcca
aacaacaataggctttttatagctcaaacaagcagtccgatggaagccaaaagaggggag
ttggagatcatgaccattcctgtttccacaaacaaccccgagaacttctccggcgaagga
aaagacttgaatgaggatggttatccaattcccaaaagtcctctgtcagcagagaatgaa
aaagatgcagagggaagtggaggaaaagacttaccgttcacccttaacgcacaaatgaaa
ggatccgatgaccccggtgtcccacaggagaccacggtcaaatggcagcttatgagtctc
cagacgactcaaccttctggagcatccagtccttcagaaaccaagcatgtggaaccgacc
agcacagtcaaggaggccaggggggaaatcatgtacgtccaccgacccgttgaaaaacgc
aaaaacagtccctcaaataaagtcaacgtgccttttgttcaacggaagcaagagttgaca
ccggaagtacaaaccttcaacacacctaccacaccgagtcctgtccatgccatagaggac
aaactaacaatttcaccaacgccttcccaacctgtcgaagaaaccaccactgaagatatt
ttgtgcactccagatccatcagtctctagcacatggttacctgtggttcaggaggaggtc
gatacaccacaaccatcagtttcttcaacaacaatcacccaagctggacttgcagctcaa
ccgactcctccagatccaaaggatgcttcccagcaggccgagtctaggtctggagggtca
gagtcatttgtgttggctcgtggttggactactcctaaaacggtttctgcagaggaacct
tcattccagactacagggaaccctgagagagactctacaaatgcagctgtcacagtgttg
gaaaacagcacctctaaaacttcagaagatgatccctgccagaccaatccatgcctgcat
ggtgggagctgtctgattgaaggagggggctacagttgcctttgccctcagggctattca
ggagagagctgtgagatcgatattgatgattgtcagtcgaatccatgtcagaatggagga
acctgcattgacgagatcaactcttttgtgtgtctgtgtttgcccagttatggaggagcc
acttgtgagaaagacactgaaggctgtgagcacaactggaggaagtttcatggccactgc
tacaggtacttcacccgcagacacacatgggaagatgcagaaaaggactgcagagagcac
aacggtcacctggctagcatccattccgctcaagagcaggatttcattaatggaatgagc
catgaaaacacatggattggtctgaacgacagaatggttgaagacgatttccagtggacc
gacaacatggacctgcaatacgagaactggagggagaaccagccggataatttctttgca
ggcggagaggactgcgtggtgatgatcgcccatgagaacggcaagtggaacgatgtgccc
tgcaactacaacctgccctacatctgcaagaaaggcacagtactatgcggaactccgccc
accgtggacaatgctttcctgattggccggaagcgttctcattatgacattcactctgtg
gtgcgttaccagtgcggcgatggcttcctccagcgtcacgtccctaccgtgaagtgccgt
gccaacggcaaatgggacaggcccaagatcatctgcacgaagtcacggaggtctcaccgc
tacagacgccaccaccacaagtcccaccacgagcgcagaaagcacaagaggcacggctca
ggaggaggccatcgaggtcaacaggagggtcatggccatttctaa

DBGET integrated database retrieval system